KEGG   Methanohalophilus halophilus: BHR79_03810Help
Entry
BHR79_03810       CDS       T04572                                 

Definition
(GenBank) glutaminyl-tRNA synthase (glutamine-hydrolyzing) subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz00970  Aminoacyl-tRNA biosynthesis
mhaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    BHR79_03810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mhaz03029]
    BHR79_03810
Enzymes [BR:mhaz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     BHR79_03810
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     BHR79_03810
Mitochondrial biogenesis [BR:mhaz03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BHR79_03810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: APH38698
UniProt: A0A1L3Q1E5
LinkDB All DBs
Position
785257..786678
Genome map
AA seq 473 aa AA seqDB search
MLDGLSDIKNRIVSSSAEEVVASYLERIEKSNINAFTCIAEDAIEQAKKVDSLDIEGPLA
GVPIAIKDNISTKGLSTTCSSAILEGYVPPYDAHVIERLRKAGAVIIGKSNMDEFGMGTS
TETSTYGPTLNPWDTERVAGGSSGGSAAAVAAGQVPVSLGSDTGGSVRCPAAFCGAVGLK
PTYGAVSRYGLVSYANSLEQIGPLANRVEDVAALMDVIGTYDNRDSTCVKHNAGYTDTLQ
DGVDGLKIGVPDEYFGEGIDDNVQKLVWDAIGKFEDMGAEYTKVSMPNTPYALAAYYIIA
MSEASSNLARFDGTRYGNRSEGENWHMMASKTRQEKFGAEVKRRILLGTYALSAGYHDKY
YLKALKVRTLVKQDFERAFEDVDVLMAPTMPTPAFKIGEKMDDPLSLYLSDVNTVPINLA
GVPSISVPCGFSEGLPVGLQVIGNYFDEATILKAAHSFEKNTDHHTKLAAEVV
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgctggacggtttatctgatataaaaaacaggattgtttcctcatcagccgaggaagtt
gttgcctcctatctggaaagaatagaaaaaagtaacattaacgccttcacctgtattgca
gaagatgctattgagcaggctaaaaaagttgactctctggatattgaaggtcctcttgca
ggtgtgcccattgcaatcaaggataatatttccacaaagggattatccacaacctgcagt
tctgccatccttgaaggttatgtgccaccctatgatgctcacgtgatcgaaagattgcga
aaggccggtgcagtgataatcggcaagtccaacatggatgaatttggtatgggtacttcc
actgaaacaagtacctatggtccaactcttaatccctgggatacagaaagagtggctgga
ggatcgtcaggtggcagtgccgccgctgtagctgcagggcaggttcctgtctcgctgggc
tcggatacaggtggctcggtgcgttgcccggcggctttttgtggggccgtgggcctgaaa
ccaacctatggggcggtctccaggtacggattggtttcttatgccaactctttagaacag
attggccccctggcaaatcgtgttgaagatgtcgcagccctgatggacgttattggcaca
tatgataaccgggattcaacctgtgttaaacataatgccggttatactgatacccttcag
gatggtgtggacgggttaaagatcggagttcctgatgaatacttcggggaaggcatcgat
gataatgtacagaaactggtatgggatgccattggtaaattcgaggacatgggagctgaa
tacacaaaagtttccatgccaaacacgccttatgcactggcagcatattatatcatagcc
atgagtgaagcttcttccaaccttgcccgttttgacggtactcgctatggcaatcgttca
gagggggagaactggcatatgatggcttcaaagaccaggcaggaaaagtttggtgcagag
gtaaaaagacgtatcctgcttggaacttatgctctttctgcgggctatcatgacaaatat
tatctaaaggccctcaaggtccgcactcttgtaaaacaggattttgaaagagcctttgag
gatgtggatgtattaatggcacccacaatgccaactcctgccttcaagataggggaaaaa
atggatgatccactgtccctgtacctctcggatgtcaacactgtcccgattaatctcgca
ggggtgccttccatatcagtgccgtgtggcttttccgaaggtctgcctgtaggactgcag
gtaatcgggaactactttgatgaagctactattctcaaagcagcccactcttttgagaaa
aataccgatcatcataccaaattggccgcagaggtggtataa

DBGET integrated database retrieval system