KEGG   Methanohalophilus halophilus: BHR79_09740Help
Entry
BHR79_09740       CDS       T04572                                 

Definition
(GenBank) alpha-amylase
  KO
K07405  alpha-amylase [EC:3.2.1.1]
Organism
mhaz  Methanohalophilus halophilus
Pathway
mhaz00500  Starch and sucrose metabolism
mhaz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhaz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    BHR79_09740
Enzymes [BR:mhaz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     BHR79_09740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_57 Polysacc_deac_1
Motif
Other DBs
NCBI-ProteinID: APH39730
UniProt: A0A1L3Q4D1
LinkDB All DBs
Position
1915423..1916628
Genome map
AA seq 401 aa AA seqDB search
MKAVCMYFELHQPYRLKWFWPDHSEGFERYFDTAINREIFEKVADKCYLPATKTMLQLIE
QYEGDFRFSISVTGTLLSQCKKWNPKVIELFQALADTGCVEFLDETNYHSLAGLFDDKSE
FIEQVREHHKLISETLGAKPLFFRNTELLYNNSIAKTVSEMGYSGILIEGVDGLVDTPNY
VYNSKNCDLKVLLRNYKMSDDIGYRFSARWWSEYPLTASKWADWATHQEGEILNIFMDYE
TFGEHQWTETGIFDFLRELPGEVLERNLTFQTPSEIIGKYDPVGEIDVKDLSTISWADIE
RDTSAWLGNDMQRRCFEEVKLLEPYVKKTGDKELIKIWKHLLTSDHYYYICTKWLGDGDV
HSYFSIHTSPYEAAINFMAIINDFKSQVFKNLAAKDKNIYT
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcagtatgcatgtatttcgaacttcatcaaccctatcgccttaaatggttctgg
ccagatcattcagaaggattcgaaagatatttcgatactgcgataaacagggaaatattc
gaaaaggtggctgacaagtgctaccttccggctacaaaaaccatgcttcagcttatcgaa
cagtatgaaggggatttccgctttagtatttcagttaccggtacactgttgagccagtgc
aaaaaatggaatccgaaggtcatagaactctttcaggcactggctgataccggatgcgtt
gaatttttggatgaaacgaattatcattccctggcagggctttttgatgacaagagcgaa
tttattgaacaggttcgtgagcaccacaaattgatttcagaaacactgggtgcaaaacca
ctttttttcaggaatacagaactgctctacaacaacagtattgcaaagactgtctctgag
atgggatatagcggcatactcatagaaggagttgatgggcttgtagatactcccaactat
gtctataattcaaagaattgtgacctgaaggtgttattgcgtaattacaagatgagtgat
gatataggataccgcttttcagcacgctggtggagcgaataccctttaactgccagtaaa
tgggcagattgggccacacatcaggaaggagaaattctcaacatcttcatggactatgaa
acctttggggaacaccaatggacagaaacaggcatatttgactttcttcgcgagcttccc
ggagaagttttggaaagaaacctcacattccagacaccttcagaaattatagggaagtac
gaccctgtgggcgaaatagatgtgaaggatctcagtactatttcatgggcagatattgaa
agagataccagtgcctggttgggtaatgatatgcaaaggcggtgtttcgaggaggtcaaa
ttactcgaaccctacgtgaaaaaaacaggcgacaaagaactcataaaaatatggaagcat
ctcctgacatcggaccattattattacatatgtacaaaatggctcggagatggtgatgta
cattcttatttcagtattcatacctccccatatgaagcagccatcaatttcatggcaata
atcaatgacttcaaatcacaggttttcaaaaaccttgccgccaaggataaaaatatctac
acgtaa

DBGET integrated database retrieval system