KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0078Help
Entry
MARHY0078         CDS       T02083                                 

Gene name
idh
Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00020  Citrate cycle (TCA cycle)
mhc00480  Glutathione metabolism
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01120  Microbial metabolism in diverse environments
mhc01130  Biosynthesis of antibiotics
mhc01200  Carbon metabolism
mhc01210  2-Oxocarboxylic acid metabolism
mhc01230  Biosynthesis of amino acids
Module
mhc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mhc_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MARHY0078 (idh)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    MARHY0078 (idh)
Enzymes [BR:mhc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     MARHY0078 (idh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH DUF5363
Motif
Other DBs
NCBI-ProteinID: CCG93582
UniProt: H8WAX5
LinkDB All DBs
Position
92902..95184
Genome map
AA seq 760 aa AA seqDB search
MTVLNPPNSLRTKMTSSKAKIVYTLTDEAPALATRSLLPILETFAKPAGIDFETSDISLA
ARILAGFPDYLEEDQRVPDALAELGEYTKDPDANIIKLPNISASIPQLRAAIKELNEQGY
KVPEYKEHPETDEEKEIHARYSKVLGSAVNPVLREGNSDRRAPAAVKAFARKYPHTMGEW
SPASRTHVAHMRGGDFYSSEQSVTLDKATNARIVFENKKGEQTVLKSDLPLQEGEVLDGM
FMSKKALVKFFEDAIADCENTGVMFSLHVKATMMKISHPIVFGHAVKVFYKELFDKYGEL
FQEIGVNPNNGLSSVIEKIKQLPESKQEQIQEDLHACYEHRPEIAMVDSVKGITNLHVPS
DVIVDASMPAMIRNSGKMWARDGKLKDTKAVMPESTYATIYQEVINFCKTHGAFDPTTMG
TVPNVGLMAQKAEEYGSHDKTFEMKEDGVVRVVAEDGTVLTEHKVEEGDIWRACQTKDLP
IRDWVKLAVNRSRSSGMPAVFWLDDERAHDAQLIKKVKTYLADLDTEGLDIRIMSPVRAI
RWTMERLIRGLDTISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLLNGGGLYETGAGGS
APKHVQQLIQENHLRWDSLGEFLATAVSLDELGEKQNNERARLLGQTMDKATERLLENNQ
SPSRVTGELDNRGSHFHLARYWAEELSKQDEDKELKEFFTKLSAQLEENKDKILEEMTVV
QGHPADIGGYYHPPMEKVCEVMQPSATFNKILAEARDSVN
NT seq 2283 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcctgaacccacccaatagcctgaggacgaaaatgacatcatccaaagccaag
attgtctacacgttgaccgacgaggctcccgccctcgccacccggtcactgcttcccatc
ctggaaaccttcgccaagccggctggcatcgacttcgaaaccagcgacatctctctcgcg
gcgcgtattctggcaggcttcccggactaccttgaggaagaccagcgggttccggatgcc
ctggctgaattgggtgagtacaccaaggatccggacgccaacatcatcaaactgccgaac
atctccgcctccattccgcagctgcgtgccgcgatcaaagaactgaatgagcaaggctac
aaggtgcccgagtacaaggagcacccggagaccgacgaagagaaagaaattcacgcccgc
tacagcaaggtgctgggcagtgccgttaacccggtactgcgtgaaggtaactccgatcgt
cgcgcgccggccgcggtcaaggctttcgcgcgtaagtacccgcacaccatgggcgaatgg
agcccggcctcgcgtacccacgtggcgcacatgcgcggtggcgacttttactccagcgag
cagtccgtgaccctggacaaggccaccaacgcccgcatcgtgttcgagaacaaaaagggc
gaacagaccgttctgaaatccgacctgccgctgcaggaaggcgaggtgctcgacggcatg
ttcatgagcaagaaggcgctggtgaagttctttgaggacgccatcgccgactgtgagaac
accggcgtgatgttctccctgcacgtgaaagccaccatgatgaaaatctcccacccgatc
gtattcggtcacgcggtgaaggttttctacaaggagctgttcgacaagtacggtgagctg
ttccaggaaatcggcgttaacccgaacaacggcctgtcgtccgtgatcgagaagatcaag
caactgccggaatccaagcaggagcagattcaggaagacctgcacgcgtgctacgagcac
cgtccggaaatcgccatggtcgattctgttaaagggatcaccaacctgcacgtgccgagc
gacgtcattgtcgacgcctccatgccggcgatgatccgtaactccggcaagatgtgggcc
cgtgatggcaagctgaaggacaccaaggcggtgatgccggagtccacctacgccaccatc
taccaggaagtgatcaacttctgtaagacccacggcgcgtttgaccccaccaccatgggt
accgttccgaacgtgggcctgatggcacagaaagccgaagagtacggctctcacgacaag
accttcgaaatgaaggaagacggtgtcgtgcgcgttgtggccgaagacggcactgtcctg
accgagcacaaggttgaggaaggcgatatctggcgtgcctgccagaccaaggatctgccg
atccgcgactgggtcaagctggcggttaaccgctcccgctccagcggcatgccggccgta
ttctggctggacgatgagcgtgcccacgatgcccaactgatcaagaaggtcaaaacctac
ctggctgacctggacaccgaaggtctggacattcgcatcatgtctccggttcgcgccatt
cgctggaccatggagcgtctgattcgcggcctggacacgatctctgtcaccggcaacgtg
ctgcgtgactacctgaccgacctgttcccgatcctggagctgggcaccagcgccaagatg
ctgtccatcgtgccgctgctgaacggcggtggtctgtatgagaccggtgccggcggttcc
gcacccaagcacgtacagcagctgattcaggaaaaccacctgcgctgggattccctgggt
gagttcctggccaccgcggtgtccctggacgagctgggcgagaagcagaacaacgagcgt
gcccgcctgctgggccagactatggacaaggccaccgagcgactgctggaaaacaaccag
tctccgtcgcgggtaaccggcgagctggataaccgtggttcacacttccacctggcccgc
tactgggcggaagagctctccaaacaggatgaagacaaggaactgaaagaattcttcacc
aagctgtctgcccagctggaggagaacaaggacaagatcctggaagaaatgaccgtggtg
cagggccatccggccgatatcggtggttactaccacccgcccatggagaaggtgtgcgag
gttatgcagccgagcgccactttcaacaagatcctggccgaggcacgggattccgtgaat
taa

DBGET integrated database retrieval system