KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0786Help
Entry
MARHY0786         CDS       T02083                                 

Gene name
ftsI
Definition
(GenBank) division-specific transpeptidase, penicillin-binding protein 3
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00550  Peptidoglycan biosynthesis
mhc01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MARHY0786 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MARHY0786 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
    MARHY0786 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mhc03036]
    MARHY0786 (ftsI)
Enzymes [BR:mhc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MARHY0786 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   MARHY0786 (ftsI)
Chromosome and associated proteins [BR:mhc03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    MARHY0786 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer HTH_AsnC-type Beta-lactamase2 HTH_8
Motif
Other DBs
NCBI-ProteinID: CCG94271
UniProt: H8W655
LinkDB All DBs
Position
822149..823891
Genome map
AA seq 580 aa AA seqDB search
MSGQGTHANSWKQRLVTGLKAWRFGSVLGVFLLVVAGIGWRLVDLHVVDNDFLRKQGDVR
TIRVESIDAHRGVVTDRHGEPLAVSTPVQTVWANPSETDPEDPQLAALARILGLSEGALR
ERLRQYAGREFIYLRRKVQPSMAREALALGVGGIYARQEYRRYYPAGEVTAHVVGFTDID
EHGQEGIELAYNKWLTGEPGQKRVLKDNRGRVIKDLMLIRDARPGKDLELSIDLRLQYLA
YRELKAVVGAHKARGGTLVMLDVDTGEVLAMVNQGSYNPNDRSQLAAENLRNKAITDLFE
PGSTMKPLTIAAALESGEYTVNSTIDTSPGFRRFGRFTIRDHRNYGVLDLTEIIVKSSNV
GVSNIATDLGGDTLRNLYARLGLGQATGIGFPGEAVGVLPAPPKWRPVEESTLSYGYGMS
VNALQLAQAYMVIANGGIRYPLSLMRQEQRPQGQRVLSEQVTRAVRDMLKQAVARGTGKR
AQPGLYAAGGKTGTVHLVGANGYEDSQYKAIFAGMAPIDDPRIVTVVAVDAPQAGEYYGG
EVAAPVFARVMGDALRLLNVKPELEVSETRVSQVTSGGRG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
gtgtccggtcagggaacgcacgcaaacagctggaagcagaggctggtgacaggcttgaaa
gcctggcgcttcggctctgtgctgggcgttttcctgctggttgtggccggcattggatgg
cggttggtggatcttcatgtggtggataatgacttcctgcgcaagcagggagatgtcaga
accatccgcgttgaatctatcgatgcccatcgaggcgtggtgacggatcgtcatggcgag
cctttggccgtcagtacgcccgttcagaccgtgtgggcaaatccttccgaaaccgatccc
gaagatccgcaactggcggctcttgcccgaattcttgggttgtctgagggcgcgctgcgg
gagcgattgcgccagtatgctggccgcgaatttatctacctgcgccgcaaagtgcagccc
tcaatggcgcgtgaagcgctggctctaggtgtcggtggtatctatgcccggcaggaatat
cgtcgttattaccccgcgggagaagtcaccgctcatgtggtcgggtttactgatatcgac
gagcatggccaggaaggtatcgagttagcctataacaaatggttgaccggtgagccgggc
cagaagcgggtgctcaaggataaccgtgggcgcgtcatcaaagatctgatgcttatccgc
gatgcccggcccgggaaggacctggaactgagtattgatctccggctgcagtatctggcc
tatcgggagctcaaggcggtggtcggtgctcacaaggctcgcggcggtacgctggtgatg
ctggatgtcgacaccggtgaggtgctggccatggtcaatcaaggttcctacaacccgaat
gaccggtcacagcttgccgcagaaaacctgcgcaacaaggcgattacagatctgttcgag
cccggctcaaccatgaagccgctgacgatagcggctgctctggagtccggggaatacacg
gttaacagcaccattgatacttccccgggctttcggagatttggtcgcttcaccattcgg
gatcatcgcaattacggggtgctggatctgacggagattattgtcaagtccagcaacgtc
ggggtgagcaacatcgcaacggatctgggtggcgatactctgagaaacctctatgcccgc
ctgggcctcggccaggcaactggtatcggcttccctggggaagccgttggtgttttgccg
gcccccccgaaatggcggccggtagaagagtccaccttgtcttatggctacggcatgagc
gttaacgccttgcaactggcacaggcgtatatggttattgccaatggtggaattcgttac
cccctcagcctgatgaggcaggagcagaggccgcaggggcaacgtgtactgtctgaacag
gtgacacgggccgtgcgggacatgctcaagcaggcggttgcccgtggtactggcaagcgc
gcccagcccgggctgtatgcggccggaggcaaaaccgggaccgttcacctggtgggagcg
aacgggtacgaagacagtcaatataaggccatctttgccggtatggcaccgattgatgac
cccagaattgtaaccgttgtggccgtggatgcgccgcaggccggagaatattacggcgga
gaagttgccgcgccggtattcgcccgggtgatgggtgacgcgctgcgactgctgaatgtg
aagcctgaactggaagtcagtgaaacacgcgtttcgcaagtaacttccggggggagaggg
taa

DBGET integrated database retrieval system