KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0794Help
Entry
MARHY0794         CDS       T02083                                 

Gene name
ddlB
Definition
(GenBank) D-alanine:D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00473  D-Alanine metabolism
mhc00550  Peptidoglycan biosynthesis
mhc01100  Metabolic pathways
mhc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    MARHY0794 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MARHY0794 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    MARHY0794 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
    MARHY0794 (ddlB)
Enzymes [BR:mhc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     MARHY0794 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
 Precursor biosynthesis
  Amino acid ligase
   MARHY0794 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_4 CPSase_L_D2 ATP-grasp_3 ATP-grasp GARS_A TTL ATP-grasp_5 ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: CCG94279
UniProt: H8W663
LinkDB All DBs
Position
832913..833890
Genome map
AA seq 325 aa AA seqDB search
MSDLTHNDIQPYQAPPELVRALGRVAVFMGGDSAEREVSLKSGKAVLAALQSAGIDAVGR
DIRGCLLRTVDEPDFDRVFIALHGRGGEDGTLQAILGQAGIPYTGSEVLASALAMDKLRT
KYVFEGCGLPTPAFRAMTSVSEAEDIVTALGAPLSVKPAHEGSSIGIRKVSSAAELAEAY
EAAARLDDLVLVEQWIEGPEFTVSLLQDKALPAIGLSTDHAFYDYDAKYLADDTRYRIPC
GLAPDDELRLQHLALDAFRVLGCRTWGRVDIMQDRTGEFWLLEVNTVPGMTDHSLVPMAA
KAAGISFEELVVRILRDTLAEGIDA
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatctgacccacaacgacattcagccgtatcaggcaccccccgaactggttcgg
gcactggggcgcgtggctgtgttcatggggggcgattccgccgagcgggaagtatccctg
aaaagtggcaaagccgtgctggcagcgctgcaatcggcgggtattgatgcggttggccgg
gacattcggggctgtctgctgcggaccgtggacgaacccgatttcgatcgcgtgttcatt
gcccttcatggccgtggtggcgaagacgggacccttcaggcgatccttgggcaggcaggc
attccctataccggcagtgaagtgctggcatcggcactggccatggacaaattgcgcacc
aagtatgtgttcgaaggttgtgggctgcctacgccggcatttcgtgccatgacctccgtg
agcgaggccgaggacattgtgacggcactgggggcgcccctgagtgtgaaaccggcccac
gaaggttcgagtatcggtatccgtaaagtgagcagcgcggcagagctggctgaagcctat
gaggcggcagcccggctggatgatctggtgctggtagagcagtggatcgaagggccggag
tttaccgtcagcctgctacaggacaaagcgttaccggcgattggcctgagcaccgatcac
gccttttacgactatgacgccaagtacctggcggacgatacccggtaccgtattccctgt
ggtctggcgccggatgacgaattgagattgcagcatctggccctggatgccttccgggtg
ctgggctgtcgcacctggggacgggtcgacatcatgcaggaccggaccggtgagttctgg
ttgcttgaggtgaacacggttcccggtatgacggaccacagcctggtgccgatggctgca
aaggcggccggcatcagttttgaagaactggtggtgcgaattctcagggatacgctggcg
gagggcatcgatgcttga

DBGET integrated database retrieval system