KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY0836Help
Entry
MARHY0836         CDS       T02083                                 

Gene name
dacA
Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase (penicillin-binding protein 5)
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00550  Peptidoglycan biosynthesis
mhc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MARHY0836 (dacA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mhc01002]
    MARHY0836 (dacA)
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
    MARHY0836 (dacA)
Enzymes [BR:mhc01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MARHY0836 (dacA)
Peptidases and inhibitors [BR:mhc01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   MARHY0836 (dacA)
Peptidoglycan biosynthesis and degradation proteins [BR:mhc01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   MARHY0836 (dacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: CCG94319
UniProt: H8W6A3
LinkDB All DBs
Position
874059..875222
Genome map
AA seq 387 aa AA seqDB search
MAFKTVTRTLFLVFSLLLMSGQASAQAVLIPSPPQIAGSSWVLMDPLSGRVIMEHNSNER
LPPASLTKMMTAYIVERELDEGRISMSDMVPISVKAWRTEGSRTFVQEGTSVSVEDLLKG
VIIQSGNDASVALAEFVAGSEGAFVDIMNQQAQLLGMKDTHFENATGLPSADHFSTAYDL
AVLARHIIQDYPENYSLYAQKHFTYNNIRQPNRNSLLWRDDSVDGLKTGHTEEAGYCLVA
SAKRGETRLIATVMGTSSSEARAQEVQKMLNYGFRYFETERLFRAGQELMASRVWGGQAD
EVSVGMPEDIYVTIPRGSREQLESVVDLDSVIKAPIKVGDELGRVRVVLDGETLVDEPVL
ALTEVPEGGLFKRIWDAIKLFFVQLFN
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atggctttcaagactgtaactcgaacactgtttctggttttttccctgttgctgatgagc
gggcaggcctcggcgcaggcggtactgatcccgtctccgccgcagattgccggtagctcc
tgggtattgatggatccgctcagtggtcgtgtgatcatggagcacaatagcaatgagcgt
ttgccaccggcgagtctgaccaaaatgatgacggcctatattgtcgagcgcgagctggat
gaaggccgtatctccatgtcggatatggtacctatcagtgtcaaggcctggcgcacagag
gggtcccgaaccttcgtgcaggagggcacctcggtgtccgttgaggatctgctcaagggt
gtgattatccagtctggcaacgatgcgtctgtggcgttggccgagtttgtggccggcagt
gaaggggctttcgtggacatcatgaaccagcaggcgcaactgctgggcatgaaagatacc
cacttcgaaaacgccaccggcctgccctccgcagaccatttctcaaccgcctacgatctt
gcggtcctggcacggcatattatccaggactacccggaaaactactcgctgtatgcgcag
aagcacttcacctacaacaatattcgtcagcccaaccgaaacagcctgctatggcgggat
gatagcgttgatggtttgaaaaccgggcacacggaagaggccggttattgtctggtggca
tcggccaagcggggtgagacccggctgattgctacggttatgggaaccagcagctctgag
gcccgggcccaggaagtgcagaaaatgctcaactacggcttccgctactttgaaaccgag
cggctgttccgtgccggtcaggagctgatggcgtccagagtgtggggcggtcaggcggat
gaggtgtcggtaggcatgccggaggatatctatgtcaccattccccgtggctcccgcgag
caactggaatcggtggtcgaccttgattccgtgataaaagcgcccattaaggtgggagat
gagctgggccgcgttcgtgtggttctggatggtgaaaccctggtggatgagccggtgctg
gcacttaccgaagtgcctgaaggcggtttgttcaagcgcatctgggacgccatcaagctg
ttttttgttcaactgtttaactga

DBGET integrated database retrieval system