KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3487Help
Entry
MARHY3487         CDS       T02083                                 

Definition
(GenBank) putative cysteine sulfinic acid decarboxylase (Csad)
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc00250  Alanine, aspartate and glutamate metabolism
mhc00410  beta-Alanine metabolism
mhc00430  Taurine and hypotaurine metabolism
mhc00650  Butanoate metabolism
mhc01100  Metabolic pathways
mhc01110  Biosynthesis of secondary metabolites
mhc01120  Microbial metabolism in diverse environments
mhc02024  Quorum sensing
Module
mhc_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    MARHY3487
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MARHY3487
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MARHY3487
   00430 Taurine and hypotaurine metabolism
    MARHY3487
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    MARHY3487
Enzymes [BR:mhc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     MARHY3487
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Beta_elim_lyase DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-ProteinID: CCG96942
UniProt: H8W7D9
LinkDB All DBs
Position
3587216..3588892
Genome map
AA seq 558 aa AA seqDB search
MTGKKKSAQASLEAMYRVFTVPEAPESTLSRIDQDISRNLAGFLQEHIVAIERDLSEVEK
DFSDYVIPEKPVFVSEQTQFLLDKLVANSVHTASPAFIGHMTSALPYFMLPLSKIMIALN
QNLVKTETSKAFTPMERQVLGQIHRLVYQEDGSFYRKWMHDPRHALGAMCSGGTVANLTA
LWVARNRAFPAEGSFRGLHEEGLFRALKYYGHEGAAIVVSKRGHYSLRKAADVLGLGRDA
LVPVETDEFNRIQTDALRDKCLELQKQKIKIMAICGVAGTTETGNVDPLDAMADIAREFG
AHFHVDAAWGGPTLFSRTHKHLLRGIEKADSVTFDAHKQLYVPMGAGLVVFKDPGLASAV
EHHAQYIIRKGSRDLGSTTLEGSRPGMAMLIHSGLKILAREGYEILIDQGIDKAKTFANM
IDEQPDFELVTRPELNILTYRYCPEDVRQALAMADELQAEKMNTCLNRITKFIQKTQRER
GKAFVSRTRLEPARYYHFPCIVFRVVLANPLTTPDILEDILREQRELSKEDGIADEIGIL
HQMAAAVLKQNQKEARQA
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaccggaaagaaaaaatccgcccaggcctcattagaggcaatgtatcgcgtgttcacg
gtgcccgaagcgccggagtcgaccctgagccggatcgaccaggacatctcccgtaacctg
gccggattcctccaggagcacatcgtcgccatcgaacgggacctgtccgaagtcgagaaa
gacttctccgactacgtcatcccggagaaacctgtttttgtctccgagcagacccagttc
ctgctcgacaaactggtggccaactccgttcataccgcgtcacccgcgttcatcggccac
atgacctcggcactgccctacttcatgctgccgctgtcgaagatcatgatcgccctgaac
cagaacctggtgaaaaccgaaacctccaaggcgttcacgcccatggaacgccaggtactg
ggccagatacaccggctggtgtaccaggaagacggttctttctatcgtaaatggatgcac
gatccccggcacgccctgggcgccatgtgttccggcggcacggtcgccaacctcaccgcc
ctgtgggtggctcgcaaccgtgccttccccgctgaaggaagcttccgcggtctgcacgaa
gaaggcctgttccgcgccctgaaatactacggccatgaaggcgccgccatcgtcgtctcc
aaacgaggccactattccctgcgcaaagccgccgatgtcctcggccttggccgggatgcc
ttggtgccggtggaaaccgacgaattcaaccgcatccagaccgatgccctgcgcgacaaa
tgtctggagctgcagaagcagaagatcaagatcatggccatctgcggcgtggccggcacc
accgaaaccggcaacgtcgacccgctggatgccatggccgatatcgcccgggaattcggc
gcccacttccacgtcgacgccgcctggggcgggccaaccctgttctcccgcacccacaaa
cacctgctgcgcggcattgagaaagccgactcggtcaccttcgacgcccacaaacagctt
tacgtacccatgggcgccggcctggtggtcttcaaagaccccggcctcgccagcgcggta
gaacaccacgcccagtacatcatccggaagggttcccgggacctcggcagcaccaccctc
gaaggctcccgcccgggcatggccatgctgatccactcaggcctgaaaatcctcgcaaga
gaaggctacgaaattctcatcgatcagggcatcgacaaagccaaaacctttgccaacatg
atcgatgaacaaccggattttgaactggtcacccgcccggaactgaacatcctgacctac
cgctattgcccggaagatgtacgccaggcactggccatggccgatgagctgcaggcagaa
aagatgaacacctgcctgaaccgcatcaccaagttcatccagaaaacccaacgggaacgc
ggcaaagcattcgtctcccgaacccgactggagccagcccgttactatcacttcccgtgc
attgtgttccgggtggttctggccaacccgttaacaacgccggatattctggaagacatt
ctcagggagcagagggaactgtcgaaggaggatgggattgccgatgaaatcggcatcctg
caccagatggctgcggcggttttgaagcagaaccagaaagaggccaggcaggcctag

DBGET integrated database retrieval system