KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3604Help
Entry
MARHY3604         CDS       T02083                                 

Definition
(GenBank) putative DNA ligase ligA, ATP-dependent
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Pathway
mhc03030  DNA replication
mhc03410  Base excision repair
mhc03420  Nucleotide excision repair
mhc03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MARHY3604
   03410 Base excision repair
    MARHY3604
   03420 Nucleotide excision repair
    MARHY3604
   03430 Mismatch repair
    MARHY3604
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mhc03032]
    MARHY3604
   03400 DNA repair and recombination proteins [BR:mhc03400]
    MARHY3604
Enzymes [BR:mhc01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MARHY3604
    6.5.1.6  DNA ligase (ATP or NAD+)
     MARHY3604
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     MARHY3604
DNA replication proteins [BR:mhc03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    MARHY3604
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     MARHY3604
DNA repair and recombination proteins [BR:mhc03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     MARHY3604
   NER (nucleotide excision repair)
    Other NER factors
     MARHY3604
   MMR (mismatch exicision repair)
    Other MMR factors
     MARHY3604
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CCG97059
UniProt: H8W8M5
LinkDB All DBs
Position
complement(3721937..3722824)
Genome map
AA seq 295 aa AA seqDB search
MPLCNTTRVRAMPLAFSFIVVSIFLSAFGHASGRPPALPLANVYHPGVNLEEYWVSEKLD
GVRVFWDGETLWSRGGYRYSAPAWFTRQFPAQPLDGELWSGRGRFAELSGVVRKVQPVGQ
EWRQVRFYVFDLPEPDRPFEQRYRRLQQLVTAADSRYLVLVEQRVVASHDELMARLEQTV
AAGGEGLMLKRRKSWYQAGRSDDLLKVKKHQDAEATVVAHLPGKGKYEGLLGALEVELES
GRRFRLGTGFTDEERHNPPAIGARVTFRYRGLTATGLPRFASFLRIRNDEPEIIE
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgccactctgcaataccacccgtgtcagggcgatgcctctggcattcagttttattgtt
gtatcaatcttcctttcagcgtttgggcacgccagtggccggccgccggctcttccgctc
gccaatgtctaccatcccggggtcaatctggaagagtactgggtcagtgaaaagctggac
ggtgtccgggtattctgggatggcgagacgctctggtctcggggcgggtacaggtatagc
gcaccggcctggtttacccgtcagtttcccgctcaaccgctggatggcgaactctggagc
ggtcgtggccgttttgcggaactatctggcgtagtccgcaaagttcagccagtaggccag
gaatggcgtcaggtgcgcttctacgtctttgatttgcccgagccagatcggccttttgag
caacgctatagacgcttgcaacagctggtgaccgcagcagattcgcgttatctggtactg
gtggaacagcgggtagttgccagccacgatgagctgatggcccggcttgagcaaacggtc
gcggccggtggtgagggactgatgctgaaacgccgcaaaagttggtatcaggcgggccgt
tcagatgacctgctcaaggtgaaaaaacatcaggatgcggaagccacagtggttgctcat
cttcccggcaagggcaagtatgagggattattgggggcactggaggtagagctggaaagt
ggtcgccggttccggcttggcaccgggtttaccgatgaggagcggcacaatccgcctgct
attggcgcccgggttacttttcgctatcgcggcctcacggctacaggcttaccccggttc
gccagctttctaagaattcgtaatgacgaaccggagattatcgaatag

DBGET integrated database retrieval system