KEGG   Marinobacter hydrocarbonoclasticus ATCC 49840: MARHY3764Help
Entry
MARHY3764         CDS       T02083                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F, FAD/NAD(P)-binding, detoxification of hydroperoxides
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mhc  Marinobacter hydrocarbonoclasticus ATCC 49840
Brite
KEGG Orthology (KO) [BR:mhc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    MARHY3764 (ahpF)
Enzymes [BR:mhc01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     MARHY3764 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 Thioredoxin_3 GIDA DAO HI0933_like FAD_oxidored K_oxygenase AlaDh_PNT_C Glutaredoxin FAD_binding_3 FMO-like NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: CCG97218
UniProt: H8W9Z9
LinkDB All DBs
Position
complement(3892551..3894116)
Genome map
AA seq 521 aa AA seqDB search
MLDANIKGQLKAYMEKLQQPIELVAAYDDSKKSEELKQLLEVIEPMSEKISLRTEESTEV
RRPSFAINRVGTDIGVRFAGIPMGHEFTSLVLALLQVGGHPSKASQEVIQQVQELEGEFE
FETYFSLSCQNCPDVVQALNLMSVLNPNIKHTSIDGALFQDEVEQREVMAVPSVYLNGQP
WGQGRMTLEEIAAKLDTNSAEKEARKINQKDAFDVLVIGGGPAGSAAAIYAARKGIATGI
AAERFGGQVADTMGIENLISVPYTEGPKLVAAMEQHVNEYEVDIMNMQRAEKLIPAEQTG
GLHEVRLANGGSLKARTVILSTGARWRQMGVPGEEEYRNKGVAYCPHCDGPLFKGKRVAV
IGGGNSGVEAAIDLAGIVGHVTLIEFGEQMRADEVLQKKLRSLNNVKIITSGQTTEVVGT
DGKVSGLNYTDRTTGESHHVELEGVFVQIGLVPNTEWLKGDIELSQHGEIIVNDRNETSI
PGVFAAGDATTVPYKQIVISMGEGSKAALSAFDFLIRNSAE
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgttggatgccaatatcaaaggacagttgaaggcctatatggaaaagctgcagcagccg
attgagctggtggcagcctatgacgacagcaagaagtccgaggagctcaagcagctgctg
gaagtaatcgagccgatgtccgagaagatcagcctgcggaccgaggaatcgactgaggtg
cgtcgtccgtccttcgccatcaatcgtgtaggcaccgacattggcgttcgctttgccggt
attcccatgggccacgaatttacttcgctggtgctggccctgctgcaggtgggtggccat
ccatccaaggcgtctcaggaagtgatccagcaggttcaggagctggaaggtgagttcgag
tttgaaacctacttctcgctgtcctgccagaactgcccggacgtggttcaggccctgaac
ctgatgagcgtgctgaacccgaacatcaagcacacctccattgacggtgccctgttccag
gacgaagttgagcagcgtgaagtgatggcggtacccagtgtttacctgaatggccagccc
tggggccagggccggatgacgctggaagagattgcggccaagctggacaccaactcggct
gaaaaagaagctcgtaagatcaaccagaaagatgcgtttgacgttctggtgatcggtggt
ggcccggcaggttctgctgcggctatctatgccgcacgaaagggcattgcgaccggtatc
gcggctgagcgttttggtggccaggtggccgacaccatgggcatcgaaaacctgatttcc
gtgccttacaccgaaggcccgaaactggtggcggccatggagcagcacgtcaacgaatac
gaagtcgacatcatgaacatgcagcgtgccgagaagctgattccggccgagcagaccgga
ggcctgcacgaggtacgcctggccaacggcggctctctgaaagctcgcacggtgattctg
tccaccggtgcccgctggcgccagatgggtgtgccgggtgaggaagagtaccgcaacaag
ggcgtggcctactgcccgcattgcgacggcccgctgttcaaaggcaagcgcgtagcggtg
attggcggtggtaactccggcgtggaagcggccatcgacctggcaggtattgtcggccac
gtgacgctgatcgagtttggcgagcagatgcgtgccgatgaagtgctgcagaagaaactg
cgtagcctgaacaacgtgaagatcattacgtctggccagaccacggaagtggtgggtacc
gatggcaaggtcagcggcctgaactacaccgaccgtaccaccggtgagtcgcatcacgtt
gagctggaaggcgtgtttgttcagatcggcctggtgccgaacaccgagtggctgaaaggc
gacatcgaactgagccagcacggcgagatcatcgtaaatgatcgtaacgagacttcgatc
ccgggtgtgttcgcggcaggcgatgccaccaccgtgccctacaagcagatcgtgatctct
atgggtgaaggttccaaggctgccctgagcgccttcgacttcctgatccgtaactctgct
gagtaa

DBGET integrated database retrieval system