KEGG   Marinithermus hydrothermalis: Marky_0350Help
Entry
Marky_0350        CDS       T01457                                 

Definition
(GenBank) Superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
mhd  Marinithermus hydrothermalis
Brite
Enzymes [BR:mhd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     Marky_0350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu CHRD
Motif
Other DBs
NCBI-ProteinID: AEB11104
UniProt: F2NQ03
LinkDB All DBs
Position
complement(340064..340627)
Genome map
AA seq 187 aa AA seqDB search
MNRSIGLLILAVIIAALFLVLRRSPAPNPPAAASPTTTEALAPLAPTSGSSVQGTVRFTQ
TDQGLRIVAEVSGLEPNTQHGFHIHEVGDCSAPDASSAGGHYNPTASAHGSPDSPEHHAG
DLGNLEAGEDGRARYERTMADLALEGGLASVLGLSVVVHANPDDLTTQPSGNAGPRVACG
VIEAAEG
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgaagcataggactcttgatcctggccgtcatcatagcggcgctcttcctcgtg
ctgcgccgctcccccgcccctaacccgcccgccgccgccagccccaccacaaccgaagcc
ctcgcacccctcgcccccacctcaggcagcagcgtccaaggcacggtgcgcttcacccaa
acggaccaagggcttcggatcgtagcggaggtgagcggcctcgagccgaacacccagcac
ggcttccacatccacgaggtcggggactgcagcgctccggacgcctcgagcgccggcggg
cactacaaccccacggcctccgcgcacggcagccccgacagtccggagcaccacgcgggc
gacctgggaaacctcgaggccggcgaggacggccgtgcccgctacgagcgcaccatggcg
gaccttgcccttgagggcggcctggcctccgtcctgggcctgagcgtggtcgtgcacgcg
aacccggacgatctcaccactcaaccctcggggaacgcggggcctcgagtggcctgtggc
gtgattgaggccgcggaggggtag

DBGET integrated database retrieval system