KEGG   Marinithermus hydrothermalis: Marky_0398Help
Entry
Marky_0398        CDS       T01457                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00473  D-Alanine metabolism
mhd00550  Peptidoglycan biosynthesis
mhd01100  Metabolic pathways
mhd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Marky_0398
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Marky_0398
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Marky_0398
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhd01011]
    Marky_0398
Enzymes [BR:mhd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Marky_0398
Peptidoglycan biosynthesis and degradation proteins [BR:mhd01011]
 Precursor biosynthesis
  Amino acid ligase
   Marky_0398
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEB11151
UniProt: F2NKW2
LinkDB All DBs
Position
381187..382161
Genome map
AA seq 324 aa AA seqDB search
MSKLRILLIAGGRSGEHEVSLASARGVLEAMPHPTDLAVIAKDGRWLTGTAARAALEAGR
AQRGEHPFPPPLSWHRYDVAFPLLHGRWGEDGTIQGFLEMLGLPYVGAGVGAAALCMDKE
LTKRTLAHAGIPVVPWVSLWRGEGLPELPFSPPYFVKPANTGSSVGISKVRTREALGPAL
EEAFRWDDRVLVEQGLEGVRELEVALLGNVTAEASVVGEVRYQSEFYDYATKYTPGRAEL
LIPAPVDADVARRLQEVARTAYRLLGVRGLARVDFFLAPDGALYLNELNTMPGFTPTSMY
PKLWQASGLEYEALLERLVRLALE
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaattacgtatattactcatcgccggggggcgttcgggggagcacgaggtctcc
ctcgcctcggcgcggggggtgttggaggccatgccccaccccaccgacctcgcggtgatc
gcgaaggacgggcggtggcttacgggaactgccgcccgggcggcgctcgaggcgggccgg
gcgcagcgcggcgagcaccccttcccgccgcccctttcctggcatcgttacgacgtggcc
ttccccttgctgcacggccgttggggggaggacggcacgatccaggggtttttggagatg
ctggggctgccctacgtaggagccggggtgggggccgccgcgctatgcatggacaaggag
cttacgaaacgcaccctggcgcacgcgggcatccccgtggtgccttgggtgagcctgtgg
cgaggcgagggcctgcccgagctgcccttttccccgccgtacttcgtcaagcccgcgaac
actggctcgtccgtagggatctccaaggtgcgcacccgcgaggcgctcggaccggccctc
gaggaggccttccgctgggacgaccgggtcctggtggagcaggggctggagggggtgcgc
gagctcgaggtggcccttttgggcaacgtgacggccgaggcgagcgtggtgggggaggtc
cgttaccagagcgagttctacgattacgcgaccaagtacaccccgggacgggccgagctc
ctgattcccgcgcctgtagacgcggacgtggcgcgccgccttcaggaggtcgcccggacg
gcctaccgccttctcggggtgcgcggcctggcgcgcgtggacttcttcctcgccccggat
ggggcgctctacctcaacgagctcaacaccatgcccgggttcaccccgacgagcatgtac
cccaagctctggcaggcctcggggctggagtacgaagcgttgctcgagcggctcgtacgc
ctcgcgcttgagtga

DBGET integrated database retrieval system