KEGG   Marinithermus hydrothermalis: Marky_0668Help
Entry
Marky_0668        CDS       T01457                                 

Definition
(GenBank) lysine biosynthesis enzyme LysX
  KO
K05827  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase [EC:6.3.2.43]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00300  Lysine biosynthesis
mhd01100  Metabolic pathways
mhd01210  2-Oxocarboxylic acid metabolism
mhd01230  Biosynthesis of amino acids
Module
mhd_M00031  Lysine biosynthesis, mediated by LysW, 2-aminoadipate => lysine
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00300 Lysine biosynthesis
    Marky_0668
Enzymes [BR:mhd01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.43  [lysine-biosynthesis-protein LysW]---L-2-aminoadipate ligase
     Marky_0668
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RimK ATP-grasp_3 GSH-S_ATP ATP-grasp CPSase_L_D2 ATPgrasp_ST ATPgrasp_YheCD ATP-grasp_5 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: AEB11418
UniProt: F2NL15
LinkDB All DBs
Position
complement(646112..646957)
Genome map
AA seq 281 aa AA seqDB search
MLAILYDRIRTDERLLFEAAERLGVPYRKIYLPRLRMTLDARPPELEGVTVVVERAVSQS
RGLAASRYLQALGIPVVNRPEVIEVCGDKWATSCALAAAGVPQPRTALTLEAETTLEVLE
AWGYPVVMKPVVGSWGRMVARVNDRDAAEALLEHKAFMGYQHQLHYLQEYVEKPGRDIRA
FVVGDRTIAAIYRSAPHWITNTARGGTASNCPVTPELDRLAVKAAQAVGGGVVAVDLFET
PNGLVVNEVNHTMEFKNSVDTTGVDIPRKILEYALALREAA
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccatcctctacgaccgcatccgcaccgacgagcggctgctcttcgaggccgct
gagcgcctgggggtcccgtaccggaagatctacctgccgcggcttaggatgaccctggac
gcgcgcccccccgagctcgagggcgtcacggtcgtggtggaacgcgcggtgagccagtcc
cggggcctcgccgcgagccggtacctccaggccctcggcatcccggtggtgaaccgcccc
gaggtgatcgaggtctgcggggacaagtgggccacgagctgcgccctcgccgccgcaggc
gtgccccaaccccgcacggcgctcaccctagaggccgaaaccaccctcgaggtcctcgag
gcgtgggggtaccccgtggtgatgaagcccgtggtgggctcgtgggggcgcatggtggcc
cgcgtcaacgaccgcgacgcggccgaggccctcctggagcacaaggccttcatggggtac
cagcaccagctccactacctccaagagtacgtggagaaacccggccgggacatccgggcc
ttcgtcgtgggcgaccgcaccatcgccgcgatctaccgcagcgcgccgcactggatcacg
aacaccgcccgcggcgggacggcctcgaactgccccgtcacccccgaactggaccggctc
gcggtcaaggccgcccaagccgtagggggcggggtggtcgcggtggacctcttcgagacc
cccaacgggctcgtggtgaacgaggtcaaccacaccatggagttcaagaactcggtggac
accaccggcgtggacattccccgaaagatcctcgagtacgccctagcgctacgggaggca
gcgtga

DBGET integrated database retrieval system