KEGG   Marinithermus hydrothermalis: Marky_0885Help
Entry
Marky_0885        CDS       T01457                                 

Definition
(GenBank) Phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhd  Marinithermus hydrothermalis
Pathway
mhd00620  Pyruvate metabolism
mhd00680  Methane metabolism
mhd01100  Metabolic pathways
mhd01120  Microbial metabolism in diverse environments
mhd01200  Carbon metabolism
Module
mhd_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mhd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Marky_0885
  09102 Energy metabolism
   00680 Methane metabolism
    Marky_0885
Enzymes [BR:mhd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     Marky_0885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2 VARLMGL
Motif
Other DBs
NCBI-ProteinID: AEB11631
UniProt: F2NP43
LinkDB All DBs
Position
857309..859969
Genome map
AA seq 886 aa AA seqDB search
MDAFGVLKREVDRLGRALGHAIRTLSGKKLFDLEEEVRALTKHLRAHPEDAAARARLEAR
IRSLSLDEAEGLVRAFSTYFHLVNLAEDRHRVRVNRLRDAEATPDAPRPESLMGLVGELK
KRGFSAEEAAALLRKVRLHLTFTAHPTETRRRTVRHHLQAIARLLEQLEQGAAPQEALEA
RVCLLWGTQELRKTQPSVTDEVKGGLYYLQTTLWEALPRLVEGLERAFQVHYGTRVALEP
PVRFRSWIGGDRDGNPNVTPEVTAWAQHHARARLIQRYLEALDGLVQALSLAEERVPVPR
ELRLVAEGWAERLGLPKRFLGEPYRRYLMALHRRLRGTLGEPNGEAYSTPQAFVEDLERV
ERGLFQIGLDAVVRTMVRPLTLRAKTYGLDLVALDLREEAQQHAEAVAELLEAAGVTADY
RERPPESREALLTAELASARPLAPVGYSPRTRALRVALEALRAWRAYGGYVISMAQHPAD
ALEVFVLAREVGLYRPGQALPFDVVPLFETLADLERAPGVVARLLENPVFRAHVKARGGL
EVMIGYSDSNKDAGFLAANWALYRAQEGIARVARAAGVPVFFFHGRGTSTARGGAPAGRA
IAALPWGTVGMRMRLTEQGEALADRYAHAELALRHLEQLLYHFVLAAARDLRGEGDPPPK
AWLEAMDRAAARAAEVYRALLAAPGFFEFYEALTPIREIADLKIASRPVYRHGRVREIRD
LRAIPWVMSWAQVRANLPGWFGLGSGLEVLPLELRRAMYRGWPFFASVLESAAVSLAKAD
LGITRSYLRLVPEALAQRFFPVIEAEFAKSRRLLEETFDRPLLWNQQTLARSIALRNPYV
DPISHVQAELLARYRSAPPDAPERAQLERALLASLLGIAAGLRNTG
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
gtggacgccttcggagtactaaagcgcgaggtagatcgcttagggcgggcgctcgggcat
gcgatccgcacgctctccgggaagaagctattcgatttggaggaggaggtgcgcgccctg
accaaacacctccgcgcgcatcccgaagacgccgcggcccgcgcgcggctcgaggcccgc
atccgcagcctgagcctcgacgaggccgaggggttggtgcgtgccttctccacctacttt
cacctggtgaacctggcggaggaccggcaccgggtgcgcgtgaaccgcttgcgggacgcc
gaggccaccccggacgcgccgcgcccggagtccctgatgggcctcgtgggggaactcaag
aagcgaggcttcagcgctgaggaggccgccgcgctgttgcggaaggtgcggctgcacctc
acctttaccgcgcaccccaccgagacccgccgacgcacggtacggcaccacctgcaagcg
atcgcacgcctgctcgagcagctcgagcaaggcgcggccccccaggaggccctcgaggcc
cgggtctgcctgctctggggcacgcaggagttgcgtaagacccagcccagcgtgacggac
gaggttaagggcgggctttactacctccagaccacgctttgggaggcgttgccgcggcta
gttgaagggctcgaacgcgccttccaggtccattacggcacgcgggtcgcgctcgagccg
cccgtgcgattccgcagttggatcggtggggaccgggacggaaacccgaacgttacgccc
gaggtcaccgcatgggcccagcaccacgcccgcgcgcgccttatccagcggtacctggag
gcgcttgatgggctggtgcaggccctgtcccttgcggaggagcgggtcccggttccgcgc
gagctgcgcctcgtggccgagggttgggccgagcggctgggcctacccaagcgttttctg
ggcgagccctaccggcggtacctgatggcgctgcaccgccgattgcggggcacgctgggc
gagccgaacggcgaggcttactccacgccccaggccttcgtggaggacctggagcgcgtc
gagcgcggcctcttccagatcggtctggacgccgtggtccgtaccatggtgcgccccctc
accctgcgggccaagacctacgggttggacctggtggccctggacctgcgcgaagaggcc
caacagcacgccgaagccgtagcggagctcctcgaggcggccggcgtaaccgcggactac
cgcgaacgccctccagagtcccgcgaggcgctattaaccgcggagcttgcgagcgcccgg
cccctcgcgcccgtcgggtactcgccccgcactcgagccctccgggtcgcgctcgaggcc
cttcgtgcctggcgtgcttacggcgggtacgtgatcagcatggcccaacaccccgcggac
gcgctcgaggtcttcgtgctcgcccgagaggtggggttgtaccggccggggcaggctctg
ccctttgatgtcgtgcctttgtttgagacgctggccgacctcgagcgcgccccaggggtg
gtggcgcggcttttggagaacccggtgttccgcgcgcacgtgaaggcccgggggggcctc
gaggtgatgatcgggtactcggactccaacaaggatgcgggcttcctcgcggcgaactgg
gccctctaccgcgcgcaggaaggcatcgctcgggtcgcgcgcgcagcaggggtgccggtc
tttttcttccacgggcgcggcacaagcaccgcgcgcgggggggctccggcaggccgggcg
atcgcagcgctgccgtggggtaccgtgggcatgcgcatgcgcctcaccgagcagggcgag
gcgctcgcggaccggtacgcgcacgcggagctggccctgcgccacctggagcagctgctc
taccacttcgtcctcgccgcggcgcgggacctgcgcggtgagggagacccccccccgaag
gcctggctcgaggcgatggatcgcgcggccgcgcgggcggccgaggtgtaccgggcgctg
ctcgccgccccggggttttttgagttttacgaggcgttgacgccgatccgggagatcgcg
gacctgaagatcgcttcgcgtcccgtgtaccggcacggccgcgtgcgcgagatccgggac
ctgcgcgcgatcccctgggtgatgtcctgggcgcaggtgcgggcgaatctgcccgggtgg
ttcgggctgggctccggcctcgaggtgctcccgctggagctgcgccgcgccatgtaccgg
gggtggccgtttttcgcttcggtactggaaagcgcggcggtcagcctggccaaggcggac
ctggggattacccggagctacctgcggctcgtgccggaggccctcgcccagcggtttttc
ccggtgatcgaagcggagttcgcgaaaagccggcgccttttggaggagaccttcgaccgg
ccgcttctttggaaccagcaaaccctcgcgcgttcgatcgcgttacggaacccgtacgtg
gacccgatcagccacgtgcaggccgagctgctcgcccgttaccgcagcgcgccgccggac
gcgccggagcgcgcgcagctcgagcgggcgttgctcgcgagcctcttggggatcgcggcg
gggctgcgcaacaccgggtga

DBGET integrated database retrieval system