KEGG   Methylocystis heyeri: H2LOC_017095
Entry
H2LOC_017095      CDS       T06290                                 

Gene name
tssK
Definition
(GenBank) type VI secretion system baseplate subunit TssK
  KO
K11893  type VI secretion system protein ImpJ
Organism
mhey  Methylocystis heyeri
Brite
KEGG Orthology (KO) [BR:mhey00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:mhey02044]
    H2LOC_017095 (tssK)
Secretion system [BR:mhey02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   H2LOC_017095 (tssK)
SSDB
Motif
Pfam: T6SS_VasE Abi_C
Other DBs
NCBI-ProteinID: QGM47264
UniProt: A0A6B8KFT1
LinkDB
Position
complement(3802697..3804034)
AA seq 445 aa
MSWRSKVVWREGLFLRPHHLQQADRYLERLVEARTSHISPYPWGFSHLEIDLDLAQQSKF
ALRKATGLMPDGTPFDAPDDGMPPLAIEAPENCAGLTVWLTLPHVVSNTREVDHRTKEAA
SRYVEGVETIIDTVSELRNEEEIDVAHLRLALEIGRTPKQGYNCLAVARIVEIRDRALIF
DQKFAPPVLISAAHPVVSGWIDRVIGWIDNKVEELARYAADPSAGGGLQSVDYFMLQTLN
RAIPLLRHLRQSGYTHPERIYAAFTSLAGELATFAALDRRARTYPAYDHDHLEDVFEPIL
RDLQEFLSANLGRRAIRLELIQRATNAYVSPIRDRSLFRNATFVLEVSAALPLTDIQQQL
PQLFKLGPNGRMNEIVHANLPGVRLVHMPTPPAQIRAISNHVYFFLDKQSPLWPEFSNAA
SIGLHFSGDWPELQLELWAVLEGAR
NT seq 1338 nt   +upstreamnt  +downstreamnt
atgtcctggcgcagcaaggtcgtttggagagaggggttgtttttacgccctcaccatctg
caacaggccgaccgctatctcgaaaggctcgtcgaagcccgcacttcgcatatctccccc
tatccatggggcttttcgcatcttgaaatcgacctcgatcttgcgcagcaaagcaagttc
gccttgcgtaaagccacgggtctgatgcccgacggcaccccgtttgacgcgcccgacgat
gggatgccgccgctcgcgatcgaggccccggagaattgcgccggactgaccgtctggctc
accctgccgcacgtcgtctccaacacacgcgaagtcgatcatcgcacaaaagaggccgcg
agccgttacgtcgaaggtgtcgagaccatcatcgacacggtttccgagctgcgcaatgaa
gaagaaatagacgtagcgcatttgcgcctcgccttggaaatcggacgcacgcccaaacag
ggttacaattgcctcgctgtcgcgcggatcgtcgaaatccgcgaccgtgcgctgatcttc
gaccaaaaattcgcgccgccggtattgatcagcgccgcgcatcccgtggtttcgggctgg
atagatcgcgtcatcggctggatcgacaataaggtcgaggaactcgcgcgctacgccgca
gacccgtcggcggggggtgggctccaaagcgtcgactatttcatgttgcagacgctcaac
cgcgcgatcccgctgctacggcatttgcgtcagtccggctacacacatcccgaacgcata
tatgcggcgttcacctcgcttgcgggcgaactcgcgaccttcgccgctttggatcgtcgt
gcgagaacctatcctgcatatgatcacgaccatctcgaggacgtgttcgaaccgatcctg
cgtgatttacaggagtttttgagcgccaatctcggacggcgcgccatccggctcgaactc
atccagcgggcgaccaacgcctatgtctctcccattcgcgatcgttcgctgttccgcaat
gcgaccttcgtgctcgaagtctccgctgcgctgccgctcacggacatacagcagcagttg
ccgcagctgttcaagctcgggcccaatggccgcatgaacgagatcgtgcacgcgaacctc
cccggcgtgcggctcgtgcatatgccgacgccgcctgcacagatccgcgcgatctcaaac
cacgtctatttctttctcgacaagcagtcgccgctctggccggaattctcgaacgccgct
tcgatcggtctgcacttctccggagattggcccgaactgcagcttgaactctgggcggtg
ttggaaggggcgagatga

DBGET integrated database retrieval system