KEGG   Mycoplasma haemofelis Ohio2: MHF_0010Help
Entry
MHF_0010          CDS       T01944                                 

Gene name
proS
Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
mhf  Mycoplasma haemofelis Ohio2
Pathway
mhf00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mhf00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    MHF_0010 (proS)
Enzymes [BR:mhf01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     MHF_0010 (proS)
Amino acid related enzymes [BR:mhf01007]
 Aminoacyl-tRNA synthetase
  Class II (G/C)
   MHF_0010 (proS)
Transfer RNA biogenesis [BR:mhf03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MHF_0010 (proS)
 Prokaryotic Type
    MHF_0010 (proS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2b ProRS-C_1 HGTP_anticodon
Motif
Other DBs
NCBI-ProteinID: AEG72331
UniProt: F6FJB2
LinkDB All DBs
Position
7097..8500
Genome map
AA seq 467 aa AA seqDB search
MSLKEDNLVKWYESVISNSGIAFPGLVKGTLFIGHRGWNIWEKIRDFIDAKYKQKGIKNV
SFPTFIPVAEIEREKSRLSGFNPEIYLVSRSGDEERQNFFLRPTSEILFSHYFRNILESY
EDLPLLFNQWCNVFRAEKNTKAFLRTCEFHWQEAHTLHLSKEEAMEYLKFFHETYKSLVK
DLLNIAFLEGEKTVNERFPGSEKTLTLEAIMPDGQALQIATSHYLSKNFTETFDVKYTSR
ENVVSYPHQLSAGCSTRLIGALIMSHGDDSGLVLPLSMFDVHIKFLIINGAVTEGSELHK
KFSDELKGYKVEWDFSSRSFGYKIKNEEMIGTPVSVILGPSEIKSNWALVKTRLSESKVS
IPMDQLISKIKETIDQYSSGLYSASQKNLESSIVECSSLEEASHEILKNRKIALVPWFDD
LQNEIDFKNEKLGFGPRCIKSRIVASDTLCFYSKKPATAYVYFGRSY
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
ttgtctttaaaggaggataatttagttaagtggtacgaatctgtaatttctaattcagga
attgcctttcctggattagtaaaaggaaccttatttataggtcacaggggttggaatatt
tgggagaagataagggattttatagatgctaagtacaagcaaaagggaattaagaatgta
tcctttccaacttttatacctgttgcagaaatagaaagggagaagtccagactttctgga
tttaatcctgagatttatttagtttcaagatctggagacgaagaaaggcagaacttcttt
ttaaggccaacttccgaaatactgttttcccattacttcagaaatattctggagagttat
gaggacttaccccttttatttaatcagtgatgtaatgtctttagagcggaaaagaacact
aaggcctttttaaggacatgtgaatttcattgacaggaagcccatactcttcatttatcc
aaagaggaggctatggagtatttgaaattcttccatgagacctataagtccttagttaaa
gatttattgaatatcgcttttctggagggggagaagactgtgaatgaacgttttcccggt
tccgaaaaaactttgactttagaggccatcatgcctgacggtcaagctcttcaaattgcc
acttcccattatttgtctaagaacttcactgagacttttgatgttaaatacaccagcagg
gagaatgtggttagctatccacatcaactttcagccggatgttccacaaggcttatagga
gctctaataatgtctcacggggatgatagtggattggttctccccctttctatgtttgac
gttcatattaagtttttaataattaatggtgccgtaacggagggttccgaattgcataag
aaatttagtgatgagctaaagggttacaaggtggagtgggatttcagctctagatctttt
ggttacaagataaagaatgaggaaatgataggaacccctgtttctgtaattttaggtccg
agcgagattaagtcaaattgagctttagttaagaccagactttcagaaagcaaggtatct
attcccatggatcaactgatttccaagataaaagagacgatagatcaatattcttcgggt
ctttattctgcttctcaaaaaaaccttgagtcttccatagtggaatgctcctctttagaa
gaggcatctcatgagattcttaaaaataggaaaatagctcttgttccttgatttgatgat
cttcaaaatgagattgactttaagaatgagaaattgggctttggacctagatgtattaag
tccagaatagtagcttcagataccctttgtttttatagtaaaaaaccagccaccgcatat
gtctactttggtagaagttactaa

DBGET integrated database retrieval system