KEGG   Methanosaeta harundinacea: Mhar_0357Help
Entry
Mhar_0357         CDS       T01990                                 

Definition
(GenBank) hypothetical protein
  KO
K07468  putative ATP-dependent DNA ligase [EC:6.5.1.1]
Organism
mhi  Methanosaeta harundinacea
Brite
KEGG Orthology (KO) [BR:mhi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mhar_0357
Enzymes [BR:mhi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Mhar_0357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lig_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: AET63744
UniProt: G7WM79
LinkDB All DBs
Position
complement(378941..380062)
Genome map
AA seq 373 aa AA seqDB search
MNLGAVAERLGISAERMEKILGRIVRPSDWPPPRLLRFDKAVAGIEAGTVVFDEDEIVFG
YPKIRRAMMLDPALRRHFSSGVLVEEKMNGHNVRVARVGESTVALTRGGFICPYSTEVAR
EQIPPEIFRDHPDLVLSGEMVGPKNPYVPKEVYPAEAMDFYLFDTSRKGRRDLEGPLRTH
ALAEEYGIRAVRLFGEFGLQQAAAEIREIVRDLGARGREGVIVKDPENLARPIKYTSSES
NCRDLEYAFRYYNDYGQDFFFSRVVREGFQAAEWAEGEAEFLERCLRLGRSMLTPMRETV
EAKMVGEPIVQEVEILVRDLQTARDFEEHFRRMGVRAIFDPPRNSRGGHLVKIKRLVLST
NDKTESIVEGQLW
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgaacctcggggccgtggcggagaggctcgggatctcagcggagaggatggagaagatc
ctaggacggatcgtccgcccctccgactggccgccgccccgcctcctcaggttcgacaag
gccgtcgccgggatcgaggcggggacggtcgtcttcgacgaggacgagatcgtcttcggc
taccccaagatcaggcgggcgatgatgctcgaccccgccctccggagacatttctcctcc
ggggtcctcgtcgaggagaagatgaacggccacaacgtccgggtggcaagggtgggggaa
agtaccgtcgccctaacccggggggggttcatctgcccctactcgacggaggtggcccgg
gagcagataccccccgagatcttcagggaccacccggacctggtcctctccggggagatg
gtggggccgaagaacccctacgtcccgaaggaggtctaccctgctgaggcgatggacttc
tacctcttcgacacctcccggaaggggaggagggatctcgagggtcccctccggacccat
gccctcgccgaggagtacgggatccgggccgtccggctcttcggcgagttcggcctccag
caggcagcggccgagataagagagatcgtccgggatctgggggcccggggtcgggagggg
gtgatcgtcaaggacccggagaacctcgcacgccccatcaagtacaccagctccgagagc
aactgccgggacctggagtacgccttccgctactacaacgactacggccaggacttcttc
ttctcccgggtcgtccgggaggggttccaggcggcggagtgggccgagggggaggccgag
ttcctggagaggtgcctccggctcggaaggtcgatgctcacccccatgagggagacggtg
gaggcgaagatggtgggggagccgatagtccaggaggtggagattttggtgagagacctc
cagacggcccgggacttcgaagagcactttcggaggatgggggtcagggcgatcttcgac
ccgcctcggaactctcgggggggccacctggtgaagataaagaggctcgtcttgagcacc
aacgacaagacggagtcgatcgtcgagggtcagctctggtga

DBGET integrated database retrieval system