KEGG   Mycolicibacter hiberniae: MHIB_21350
Entry
MHIB_21350        CDS       T06801                                 

Definition
(GenBank) hypothetical biphenyl dioxygenase beta subunit
  KO
K18252  phthalate 3,4-dioxygenase subunit beta [EC:1.14.12.-]
Organism
mhib  Mycolicibacter hiberniae
Pathway
mhib00624  Polycyclic aromatic hydrocarbon degradation
mhib01100  Metabolic pathways
mhib01120  Microbial metabolism in diverse environments
mhib01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mhib00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    MHIB_21350
Enzymes [BR:mhib01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.-  
     MHIB_21350
SSDB
Motif
Pfam: Ring_hydroxyl_B SnoaL_4
Other DBs
NCBI-ProteinID: BBZ23717
LinkDB
Position
2257163..2257786
AA seq 207 aa
MTATEQDRGGRLPRPDASAPWELAVLGDHAPTNVRVGRPLPFNDSRHLQAHQFLIDEAYL
LDAQQYSEWLDTLTEDIHYFMPVRVTTAAGAGFDTSPGMAHFDENKYSLSRRVARFATEH
AWTEDPPSRLRHHITNVRTFACDDDAHLIVESAELLFRSRGDVNEAALVSCGREDLLRLT
DQGWKLARRTIYVDESVLRMQNLAVFL
NT seq 624 nt   +upstreamnt  +downstreamnt
atgacggccactgagcaagaccggggcggccggctcccccggccggatgccagcgcaccc
tgggagttggcggtactgggagatcatgcgccgacgaacgttcgcgtgggaaggcccttg
ccgttcaacgattcccggcacctgcaggcgcatcagttcctgatcgacgaggcctacctg
ctggatgcacagcagtactccgaatggctcgacaccctcaccgaggacatccactacttc
atgcccgtccgggtgaccacggccgcgggtgcgggtttcgacacctcccccggcatggcc
catttcgacgagaacaaatactcgttgagcaggcgcgtcgcgcgctttgccaccgagcac
gcgtggaccgaagaccctccgtcacggctgcgccaccacatcaccaacgtccggacgttc
gcctgcgacgacgacgcacatctgatcgtcgagtccgccgagctgctcttccgcagccgc
ggcgatgtgaacgaagccgcgctggtgtcctgcggaagggaagacctgctgcgcctgacc
gatcagggctggaagttggcgcgtcgcaccatctatgtcgatgagtccgtcctgcgcatg
cagaacctggcggtgttcctgtga

DBGET integrated database retrieval system