KEGG   Metallosphaera hakonensis: DFR87_03645Help
Entry
DFR87_03645       CDS       T05471                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
mhk  Metallosphaera hakonensis
Pathway
mhk00620  Pyruvate metabolism
mhk00680  Methane metabolism
mhk00720  Carbon fixation pathways in prokaryotes
mhk01100  Metabolic pathways
mhk01120  Microbial metabolism in diverse environments
mhk01200  Carbon metabolism
Module
mhk_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:mhk00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DFR87_03645
  09102 Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    DFR87_03645
   00680 Methane metabolism
    DFR87_03645
Enzymes [BR:mhk01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     DFR87_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase_2 Y2_Tnp Mst1_SARAH
Motif
Other DBs
NCBI-ProteinID: AWR98936
UniProt: A0A2U9ISE2
LinkDB All DBs
Position
759436..760965
Genome map
AA seq 509 aa AA seqDB search
MRLIPRTMSTQHPDNALVPEWAKGEVIEGEDEVIEAYYALSNLGVHEVMWDAEGKDVDTH
VVRKLFSSFGDYFKANVLGEDLFLTYRVPNPKIEGAERKVFAETMESIPITYDVAEKFYG
RNVVPVFEVILPFTTNALDIISVARYYERAVVMEENIELHDGVHVKDLVGEIYPKRVEVI
PLIEDKDSLLNTGNIIEGYYQAIKPTYMRLFIARSDPAMNYGMLSAVLLAKYALSTAGKL
SQELGIPIYPIIGVGSLPFRGHMNPENYQRVMEEYEGVHTFTIQSAFKYDYSEEQVKGAI
SHINREEVKEPKILSMEEEKVIKEIIERYTARYQPVIEAMADLINSVALHLPRRRARKLH
ISLFGYARSTGKVILPRAITFVGSLYSIGLPPEIIGISVLGSLNENQWNVLEDNYKFLRN
DLQRASEFINWEGISSLSAHGLLSEEVHKKIEEDIKYLESLGVKIGPRSYESKKHSLLSQ
LLILSLKEKKYNEVKQYAKEMALIRKSIG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatacccaggacaatgtctacgcaacatccagacaatgcgttggttccagag
tgggctaaaggagaggttatagagggagaggacgaggtaatagaggcatattacgctctt
tcgaatctaggtgttcacgaggtaatgtgggacgcagagggaaaggacgttgacacccac
gtggtaaggaagcttttctcttcctttggggattacttcaaggctaacgttttgggggaa
gacctctttctgacctatagggttcccaaccctaagatagagggggcggagagaaaggta
ttcgcggaaacaatggagagcatacccattacgtatgacgttgcagagaaattttacgga
aggaacgtagttccagttttcgaggtcatacttccgtttaccacaaatgccctcgatatc
atctctgtggcaaggtattacgagagagctgtagtgatggaggagaacatagagcttcac
gacggcgtgcacgtaaaggatcttgtaggtgaaatttatccaaagagagtggaagtaatt
ccactcattgaggataaggactcgcttctcaatacggggaatataatagagggctattac
caggccattaagcccacatatatgaggcttttcattgctagatctgatccggcaatgaac
tacggtatgctgtcagcagttcttctagcaaaatacgcgcttagcacggcaggaaagcta
tcccaggaattaggtattccaatatacccaataataggagtcgggtccctccccttcagg
ggacacatgaatccagagaactatcagagggttatggaggaatatgagggcgttcacacg
ttcacgattcagtcagctttcaagtatgattatagcgaagagcaggtaaagggagcaatt
tcccacatcaatagggaggaagtcaaagagccaaagatcctctccatggaggaagagaag
gtaatcaaggaaataatagaaagatatactgcgaggtatcaaccagttatagaggccatg
gcagatctaatcaattcagttgcgctccatcttccaaggagaagagcaagaaaacttcac
attagcctgtttggctacgccagaagtacagggaaggttatcttgcctagggcaataact
ttcgtgggttcgctttacagtataggtcttcctccagagataatagggatttccgtgcta
gggagtctaaacgagaatcaatggaatgtcctagaggataactataagtttctcaggaac
gatcttcagagagcttccgaattcataaattgggaggggatatcttccctttcagctcac
gggctcctgagcgaagaagttcataagaagatcgaggaggacataaagtacctggaatct
cttggtgttaaaataggacctagaagctacgagtccaagaaacactccctcctctctcag
ctactgattctctctctaaaagagaaaaaatacaatgaagtaaagcagtacgcaaaggag
atggctctaataaggaagtcaattggatga

DBGET integrated database retrieval system