KEGG   Mycoplasma hominis ATCC 23114: MHO_4880Help
Entry
MHO_4880          CDS       T01122                                 

Gene name
sps1
Definition
(GenBank) Serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mho  Mycoplasma hominis ATCC 23114
Brite
KEGG Orthology (KO) [BR:mho00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mho01001]
    MHO_4880 (sps1)
Enzymes [BR:mho01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MHO_4880 (sps1)
Protein kinases [BR:mho01001]
 Serine/threonine kinases: Other
  Bacterial family
   MHO_4880 (sps1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Pkinase_fungal RIO1 APH Choline_kinase Haspin_kinase PglD_N LMBR1 FTA2
Motif
Other DBs
NCBI-ProteinID: CAX37623
UniProt: D1J8S6
LinkDB All DBs
Position
606821..607837
Genome map
AA seq 338 aa AA seqDB search
MNKIKELPGMFVLNKYFTDFELIGTGGFGEVYSATYKKNNKRVAIKILNCIDDSRWTEQR
TRFINEINILKEIHSSNVVKILGWHYKGNEVFYVMELIKGQGLKTIIAKNKKIDPDTAIM
YAKQICQGLIEIHAAKIVHRDLKPSNILIDEETNSLKLIDFGISIGESTQRVTRNYKAVG
SVQYMAPELLRGIADPSPRSDIYAFGIILFEMLEGKVPFNNHDDINQIMMMHINNELPRM
SDVNVIIPQALENIVIRCTAKSAEQRYADCVELMHDLETCLDSKRVNEKRLELNPSKSKM
KAKRIFNSKLFNIIFFTTGGFLVAFIVIFVVLFLKGIL
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaataagataaaagaattacccggcatgtttgtacttaataagtattttactgatttt
gaattaattgggactggaggatttggcgaagtttattctgctacatataaaaaaaataat
aaaagagttgcaattaaaatactaaattgtatcgatgatagccgttggacagagcagaga
acgagattcattaacgaaataaatatattaaaggaaattcatagttctaacgtagtaaag
atattaggctgacattataaaggaaacgaagttttttatgtaatggagttaattaaaggc
caaggtttaaaaacaataattgcaaaaaacaaaaaaatcgatcctgatactgcaattatg
tatgcaaagcaaatatgtcaaggtttgattgaaatccatgctgccaaaatagttcataga
gatttgaaaccaagcaatatattaattgatgaagaaacaaatagcctaaaattaattgat
tttggcatctcaataggcgaatcaactcaacgtgtaactagaaattataaagctgttggt
tctgttcaatatatggcacctgaattattgcgtggaatagctgatccttctccgagaagt
gatatatatgcatttggtataattttgtttgaaatgcttgaaggaaaggttccttttaat
aatcatgatgatattaaccaaattatgatgatgcacatcaataatgaattgcccagaatg
agtgatgtcaatgttattattccacaagcattagaaaatattgtaattcgttgcaccgca
aaatctgcagagcaaagatatgctgattgcgttgaactaatgcatgatttagagacatgt
ttagattcaaaaagagtaaatgaaaaaagattagaattaaatccaagtaaatcaaaaatg
aaagccaaaagaatctttaatagtaaattattcaatattatttttttcacaacaggaggc
tttttagtagcttttattgtgatattcgtggttttatttttaaaggggatattgtag

DBGET integrated database retrieval system