KEGG   Mycoplasma hominis ATCC 27545: MLBD4_02450Help
Entry
MLBD4_02450       CDS       T03410                                 

Gene name
proS
Definition
(GenBank) prolyl-tRNA synthetase
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
mhom  Mycoplasma hominis ATCC 27545
Pathway
mhom00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:mhom00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    MLBD4_02450 (proS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhom01007]
    MLBD4_02450 (proS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:mhom03016]
    MLBD4_02450 (proS)
Enzymes [BR:mhom01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     MLBD4_02450 (proS)
Amino acid related enzymes [BR:mhom01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   MLBD4_02450 (proS)
Transfer RNA biogenesis [BR:mhom03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    MLBD4_02450 (proS)
 Prokaryotic type
    MLBD4_02450 (proS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ProRS-C_1 tRNA-synt_2b HGTP_anticodon HAGH_C
Motif
Other DBs
NCBI-ProteinID: AIU34191
LinkDB All DBs
Position
complement(549361..550794)
Genome map
AA seq 477 aa AA seqDB search
MKKLDKITPQNEDFARWYTDVIQNGDLMAYGATKGCIIFKPLAYSIWENIQAKMDIEFKK
RGVQNVYLPLLIPESLLQKEKNHVEGFNPELATVTEVGGKKLAEKFFIRPTSETLFADLF
KNEVSSYNDLPIIYNQWVNVLRWEKTTNPFLRTREFLWQEGHTIHSSSEEAIEFAKTMHK
VYKDVIEENLAIPVVEGCKTDHEKFAGADITYTLESMMKDGKALQSGTSHYLGQNFTKAF
DITFKNNENKLINPFGTSWGTTTRLIGALIMTHGDDRGIIIPPKIARTQVDILEIFNSKD
ERVHKLALELKDALLAKNIVANIDSSNKGPGFKAANSEIHGTPLRIEIGPKDIENNSVLF
VRRDNLEKITSTIAEAADIASLLLQKIQDNLFESAKQRLQNNIVTVNNYQEFKEAIAAGH
WVYAAFDGNGDDEVKIKEETGASTRCIPFKEPIKVSNDTCFWTNRKTKRFVLFARAY
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattagataaaataacaccacaaaatgaagattttgcgcgttgatatactgac
gttatccaaaatggggatttaatggcatatggtgcaacaaaaggatgcattatttttaaa
ccattggcatattctatttgagaaaatattcaagcaaaaatggatattgaatttaaaaag
agaggcgttcaaaacgtttatttacctcttttaataccagaaagcttattacaaaaagaa
aaaaatcatgtcgaaggatttaatcctgaacttgcaactgttactgaagtaggcggcaaa
aaattggcagaaaagttttttataagaccaacttcagaaacattgtttgctgatttattc
aaaaatgaggtttcgtcttacaatgatttgccaataatttataatcaatgagttaatgtt
ttaagatgagaaaaaacaacaaatccatttttaagaacaagggaatttttgtgacaagaa
ggtcatactatccattcaagtagtgaagaggccattgaatttgccaagactatgcacaag
gtttataaagatgttattgaagaaaatttagcaattccagtagtagaaggctgcaaaacg
gatcatgaaaaatttgctggcgcagatataacatacaccttagaatcaatgatgaaggac
ggaaaggcacttcaatcgggtactagtcactatttgggacaaaattttactaaggcattc
gatataacattcaaaaataatgaaaataaattaattaatccttttggtaccagttgaggg
acaacaacaagattaattggtgcgctaattatgactcatggtgatgatcgaggaataatc
attccaccaaaaatagcaaggactcaagttgatatattagaaatttttaattcaaaggat
gaacgagttcacaagcttgcccttgaattaaaagatgcattattagcaaaaaatattgtt
gcaaacatagattcttcaaacaaaggtccaggttttaaagcagcaaattcagaaattcat
ggtacaccattgagaatagaaattggtccaaaggatattgaaaataatagtgtattattc
gttagacgtgataacctagaaaaaattacttcaacaattgctgaagcagcagatattgcc
agtctcttattacaaaaaatacaagacaatttatttgaaagtgctaaacaacgcttacaa
aataatattgtaactgttaataattatcaagaatttaaggaagcaattgctgcgggtcat
tgagtgtatgctgcatttgatggtaacggtgatgatgaagtaaaaattaaagaagaaaca
ggagcatcaacaaggtgtattccatttaaagaaccaataaaagtttcaaatgatacttgt
ttttgaactaatagaaaaacaaaaagatttgtattatttgcaagagcatattaa

DBGET integrated database retrieval system