KEGG   Methanosarcina horonobensis: MSHOH_0075Help
Entry
MSHOH_0075        CDS       T03933                                 

Definition
(GenBank) Ribulose-1,5-bisphosphate carboxylase, Type III
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
mhor  Methanosarcina horonobensis
Pathway
mhor00630  Glyoxylate and dicarboxylate metabolism
mhor01100  Metabolic pathways
mhor01120  Microbial metabolism in diverse environments
mhor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhor00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSHOH_0075
Enzymes [BR:mhor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     MSHOH_0075
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-ProteinID: AKB76558
UniProt: A0A0E3SBC0
LinkDB All DBs
Position
94080..95366
Genome map
AA seq 428 aa AA seqDB search
MLRDYIDIGYSPKGTDLICEFHIEPSAGVNFEEAATHMAGESSIDSWTEIATLSPELAEK
LKPHVFFADEKAQTVRVAYSEDLFELGSVPQVLSAVAGNILSMKIVDNLRLQDITFPKSM
LSSFKGPNFGLPGIRKLVEVQDRPLIGTIVKPKVGLNSEKHAEVAYNSFAGGCDLVKDDE
NLTDQKFNGFEKRAELTLKLAEKAESETGEKKMYLCNVTAPTCKEMIRRMNVLKDLGASY
AMIDIVPVGWTAIQTLREEAEDAGLALHAHRCMHSAYTRNPRHGISMLVVAKLCRLVGLD
QLHIGTVVGKMHGEKHEVLNLRDQCVLNKVPADESQHVLAQDWGGLKPMFPVASGGLAPT
MIPDLYSIFGKDVIMQFGGGIHAHPMGTAAGATACRQALEASLEGISLQNYAKDHKELEV
ALGKWLKK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgcttagggactacatagacataggctacagccccaagggcacagatctgatctgtgaa
tttcacatagaaccgtcagcaggcgtgaattttgaggaagctgccactcatatggcaggg
gaaagttccatagactcctggactgagattgctacactgagtcccgaacttgcagagaaa
ctgaagccccatgttttttttgcggatgagaaagctcagactgtaagggtggcttattcg
gaagacctctttgaactgggttctgtcccacaggttctcagtgctgttgcaggaaatatc
ctgagcatgaaaatcgttgacaatctcaggctgcaggacatcaccttcccgaagtcgatg
ctcagttcgtttaaaggcccgaacttcgggctgcccgggatcaggaaacttgtggaggtg
caggacaggcctcttatagggactattgtcaaaccgaaagtcggtctgaactcagaaaag
catgctgaggttgcttacaactcctttgccgggggctgcgaccttgttaaggatgatgaa
aatctgactgaccagaaatttaatggttttgaaaagagagccgaacttactctgaagctc
gcagaaaaggcagagtccgaaacaggggaaaagaagatgtacctctgcaatgtcactgcc
ccgacctgtaaggaaatgatccgccgcatgaatgtccttaaagaccttggtgccagttac
gcaatgatcgacatcgtgcctgtgggctggactgcaattcagaccctgcgcgaagaagct
gaagatgccgggctcgctcttcatgcccatcgctgcatgcattcagcctacacccggaac
ccgcgccatgggataagtatgcttgttgttgccaagctctgcaggctggtagggcttgac
cagcttcacataggcactgttgtcggaaagatgcatggagaaaaacatgaagtcctgaat
ctcagagatcagtgcgtgctcaacaaagtgcccgcggatgaaagccagcatgtccttgcc
caggactggggaggactgaaaccgatgtttccggtagcatccggaggacttgcccccaca
atgatccctgacctttactctatcttcggaaaagatgttattatgcagttcggcggcgga
attcatgcacatccgatgggcacggcagccggagccactgcctgcaggcaggccctcgag
gcaagccttgaaggaatcagcctgcagaattatgcgaaggaccacaaagaacttgaagtc
gctctcggaaaatggctgaaaaagtaa

DBGET integrated database retrieval system