KEGG   Methanosarcina horonobensis: MSHOH_1551Help
Entry
MSHOH_1551        CDS       T03933                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
mhor  Methanosarcina horonobensis
Pathway
mhor00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:mhor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSHOH_1551
Enzymes [BR:mhor01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     MSHOH_1551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AKB78034
UniProt: A0A0E3S929
LinkDB All DBs
Position
1868620..1870098
Genome map
AA seq 492 aa AA seqDB search
MVQEYKLLIGGESRDSSTGKTFDDINPATLENLATVQVAGAEDVDRAVEAAEKGFRVWSD
IPAPRRADVLFRAARILQERKEELAVLMTEEMGKVLPEARGDVQEAIDITTYAAGEGRRM
FGETTTSELKDKFCMTVLRPIGVVGMITPWNFPIAIPSWKIMPALIAGNAIVFKPASDTP
MLAIKLVEILMEAGLPPGVVSIVPGPGGSVGKSIVQHPRIRAISFTGSLDTGKWIMEECA
KTMKRVSLELGGKNPVIVMDDADLELALEGVLWGAFGTTGQRCTATSRLILHEKVKDEFI
ARLLAKTKSLRIGNGLLPETDVGPVINKSQLEKIEKYVRIGKEEGATLLLGGSRVDPGLP
GYFFEPTIFTDVMPEMKIAQEEIFGPVLSIITVSGLDEAIEVANNTKYGLSSAIYTENVG
TAFRAVEKLEAGVTYVNAPTIGAEVHLPFGGIKGTGNGFREAGTEAIKEFTEVKAVYIDY
SGRLQRAQIDTV
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggttcaggagtataagttactgataggtggggagtcgagagactcgtcaaccggaaaa
acttttgatgatatcaatccggctactcttgaaaatcttgccacggtacaggtagcagga
gccgaggatgtggacagggcagttgaggctgcagagaaagggttcagagtctggagcgac
attccggctccgagaagggctgatgtcctcttcagggcggctcgcattctgcaggagaga
aaagaagagcttgccgtactcatgactgaagagatggggaaagttctgcctgaggccaga
ggagatgtacaggaagcaatagatattacaacttatgccgcaggggaaggcagaaggatg
tttggggagaccacaacttccgaactcaaagataagttctgtatgaccgtactcaggcca
ataggggttgttggcatgataacaccctggaactttcctattgcaattcccagctggaag
ataatgccagctcttatagcagggaatgcgatcgtgttcaagcctgcaagtgacaccccc
atgcttgcgataaaactcgtggaaatccttatggaagcaggcctgcctcccggagttgta
agtattgtgcccggacctggaggaagcgttggaaaatccatagtccagcatccccgaata
agagcaatttcctttacaggaagccttgataccgggaaatggatcatggaagagtgcgca
aaaaccatgaaaagggtctctctggaactgggaggtaaaaatccggtaattgttatggac
gatgccgaccttgagcttgctcttgaaggtgtactgtggggagctttcgggacaacaggc
cagcgctgcacagctactagcaggcttattcttcacgaaaaagtaaaggacgaattcata
gcaaggctgcttgcaaaaacaaaatctctacggatagggaacgggcttcttcctgaaacg
gatgtagggcctgtcatcaataaatcccagcttgaaaaaatagaaaagtatgtcaggata
gggaaagaagaaggtgcaactctcctgctcggaggaagcagggtagatcccgggcttcct
ggttattttttcgaacctaccatcttcacggatgtcatgcctgagatgaaaattgcacag
gaagaaatcttcggtcctgtgctcagcataattacggtttcggggcttgatgaagcaata
gaggttgccaacaatacaaaatacgggctctcatcggcaatttatactgaaaatgttgga
actgctttcagggcagttgaaaaattagaagcaggagtcacatatgtcaatgcccctaca
ataggtgcagaagtccatcttcctttcgggggcataaaagggaccggaaacggtttcagg
gaagctggaacagaggcaattaaagaattcaccgaagtaaaagccgtgtatatagattat
agcggcaggctgcaaagagcccagatagatacggtataa

DBGET integrated database retrieval system