KEGG   Methanosarcina horonobensis: MSHOH_3412Help
Entry
MSHOH_3412        CDS       T03933                                 

Definition
(GenBank) Catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
mhor  Methanosarcina horonobensis
Pathway
mhor01110  Biosynthesis of secondary metabolites
mhor01130  Biosynthesis of antibiotics
mhor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mhor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    MSHOH_3412
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    MSHOH_3412
Enzymes [BR:mhor01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     MSHOH_3412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel DJ-1_PfpI Glyco_trans_4_2 MctB OB_NTP_bind
Motif
Other DBs
NCBI-ProteinID: AKB79895
UniProt: A0A0E3WUV0
LinkDB All DBs
Position
complement(4183430..4185565)
Genome map
AA seq 711 aa AA seqDB search
MDRKRMVNEKSKDEQLETVREDPESEFLTTNQGVRVSDTDISLKAGERGPTLLEDFHFRE
KLTHFDHERIPERVVHARGSGAHGFFQVYEPMTEYTGAKFLQDPNKKTPIFVRFSTVVGF
RGSADTVRDVRGFAVKFYTEDGNYDLVGNNIPIFFIQDAIKFPDVVHAIKPEQDNQIPQA
SAAHDTFWDFVACHPETAHMIMWVLSDRALPRSYRMMQGFGVNTFRFVNAEGKGRFVKFH
WKPLLGIHSLVWDETQKIAGKDPDFNRRDLWEAIEMGDYPEYEFGVQILEEEDEFKFDFD
ILDPTKVWPEEDVPVKWIGKLTLNRNPDNFFAETEQVAFCPANVVPGIDFSNDPLLQGRL
FSYLDTQLIRLGGPNFHEIPINRPLAPIANNQREGYNRTTINKGKTSYFPNSVGENLPRP
ASAEEDGYVHYMEKVEGKKIRARSEKFKDFYSQAKLFWNSMSKPEKEHIIEAFHFEVGKV
KDKKIRQAVVDVFNNVDGDLAIEIAKGVGVPAPAQKGGSPVTKESPNLSQERSEHTVKNT
IKTRKIAILAAEGYDHKDLSQVMQALKAGGANVHIISKYQGMLKSSKGEEIEVDKNYRTT
ASVLYDAVYVPGGKESIETLKMQGDAIHFVNEAFKHCKPVGASGEGVKLLKAANLPGIKL
AGQESSDQVVSDKGVVTIKKEGGSSSFNESFTAAIAKHRHWDREKKEQVPA
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atggatagaaagaggatggttaatgaaaaaagcaaagacgagcaattagaaacggtcagg
gaagatccggaaagtgaatttctgaccacgaatcagggtgtcagggtaagtgatactgat
atctcactcaaagcaggagagagagggcccacccttcttgaggactttcacttcagagag
aaattaacccattttgaccatgagagaatccctgaaagggtcgttcacgcccgtggatca
ggagcacatggtttctttcaggtctacgaacccatgacggaatatacaggtgccaaattc
ctgcaggatccaaataaaaagacgccgattttcgtgcggttttctactgtcgtggggttc
agaggttcggcagatacagtcagggacgtccggggttttgcagttaaattctatactgag
gatgggaattatgatcttgtcggcaacaatatcccaatcttcttcattcaggacgccatt
aagtttccggacgttgttcacgcgattaaacccgaacaggacaatcagattcctcaggcc
tctgcagcacatgatacattctgggactttgtggcttgccatccggaaactgcacatatg
atcatgtgggttctttcggaccgtgcacttccccggagttaccggatgatgcagggtttt
ggggttaatactttccgtttcgttaatgcggaaggcaagggcagatttgtaaagttccac
tggaaacccctactcggaattcattctcttgtttgggatgaaactcagaagatagcagga
aaagatcctgattttaatcgccgtgacctctgggaagcaattgagatgggcgactatcct
gaatatgagttcggagtgcagattctcgaggaagaggacgagtttaaatttgattttgat
attcttgaccctacaaaggtttggccggaagaagatgtgcctgttaaatggatagggaaa
ctgacccttaaccgcaatcctgacaacttctttgctgagaccgagcaggttgcattctgc
cctgcgaacgtggttccagggatagatttctccaatgaccctcttcttcagggacgcctt
ttctcatacctcgacacccagctaatccgtcttggggggcctaatttccacgaaatccca
atcaaccggccgctggcaccgatagccaataatcagagggaaggatataaccgaacaaca
ataaacaaaggcaaaaccagttatttccctaattcagtaggggaaaacctgccacgtcca
gcttctgcagaggaagacggatacgtccattatatggaaaaagtggaaggcaaaaaaatc
cgtgctcgtagcgagaagttcaaagacttttacagccaggcaaaattattctggaacagc
atgtcaaaacctgaaaaagagcatatcatagaggctttccattttgaagtaggaaaagtc
aaagataagaaaatcaggcaggcagtcgtcgatgtatttaacaatgtcgatggtgatctt
gcaatagaaatcgcaaaaggggtgggtgtcccggctccggcacaaaaaggagggtctccg
gtaactaaagagtcaccaaatcttagccaggaacgcagtgaacatacggttaagaatact
atcaaaaccaggaaaatcgccatccttgctgcggagggatatgatcacaaagatctgagt
caggtgatgcaggctttaaaggctggtggagcaaatgtccacatcatttcgaaataccag
ggtatgctaaagagctcaaaaggcgaagaaattgaagttgacaaaaattatcgcactaca
gcatcggtattatatgatgccgtatacgttccgggcggaaaagaaagcatagagactctg
aagatgcagggagatgcaatccacttcgttaatgaagcattcaagcactgcaagccagtg
ggagcaagcggtgaaggggttaagctgctcaaagctgcaaacctccccggtataaaactt
gcaggacaggaatcatctgaccaggtcgtgtccgataaaggcgtagtgaccatcaaaaaa
gagggaggcagcagctccttcaacgaatcctttactgccgcaattgcaaaacacaggcac
tgggatagggagaagaaggaacaggttccggcctga

DBGET integrated database retrieval system