KEGG   Microbacterium hominis: CXR34_02800Help
Entry
CXR34_02800       CDS       T05238                                 

Definition
(GenBank) beta-galactosidase
  KO
K12308  beta-galactosidase [EC:3.2.1.23]
Organism
mhos  Microbacterium hominis
Pathway
mhos00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    CXR34_02800
Enzymes [BR:mhos01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     CXR34_02800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_42 Glyco_hydro_42M Glyco_hydro_14 DUF4434 Cellulase Glyco_hydro_35 Glyco_hydro_2_C
Motif
Other DBs
NCBI-ProteinID: AUG28492
UniProt: A0A2K9D6K5
LinkDB All DBs
Position
599364..601418
Genome map
AA seq 684 aa AA seqDB search
MATHAREYRWVRDGAAGAGRMRYGADYNPEQWSRDVWAEDMRLMREAGVNIVSLAIFSWA
LLEPRPGEFDFGWLDEVIDLLHENGIDVDLATATASPPAWLSQRHPEILPQTEDGTVLWP
GARQHWRPTSPVFRTHALRLVRALAERYRDHPAIVAWHISNELGCHNLYDYSDDAAAAFR
TWLRDRYGTLDALNEAWGTAFWSQHYTEWEQILPPRTAPTHRNPGQRLDFERFSSDAVRD
HLRAEAAVLAELTPDIPFTTNFMVAQNVRDIDYPTWAGDVDFISNDHYLRPGELGRDDVS
FWANLTGNIAEGRPWFLMEHAPSAVNWREVNPPKRPGELMRDALTHVGHGADAVCFFQWR
QSRAGGERFHSGMVPHAGEHSRVFRDVAALGARLGELGAVTGSHRERARVALVFDYESWW
VSGRDSHPSDALRYDDETLAWYRALLDLGVRADVVPVAASLDGYDVVVAPMLHVVPDALR
TRLEHVVRSGRHLVTTAFSGIVDQHDRVWLGGYPGALREVLGVTVEEFVPLLADETARLA
SGAVATHWSERISHVADDVEVLDTYAAGDLAGMPAVTRRRVGAGSATYVSADTGRDGARA
VLERLAGDIGALAGDPLAADGRLEVIVRVDAARRHVFVVNRTDDEVVVDDPELGALRVAP
RGVETRSIPAQEPALAGAHGRMDA
NT seq 2055 nt NT seq  +upstreamnt  +downstreamnt
atggcaacgcacgcgcgggagtatcgctgggttcgagacggagcagcgggggcaggacgc
atgcgctacggcgcggactacaaccccgagcagtggtcacgcgacgtctgggcggaggac
atgcgcctcatgcgcgaggccggcgtgaacatcgtctctctcgcgatcttctcgtgggcg
ctgctggagccgcgtcccggcgagttcgacttcggctggctcgacgaggtcatcgacctg
ctccacgagaacgggatcgacgtcgacctcgccaccgccacggcatccccgcccgcgtgg
ctctcgcagcgtcaccccgagatcctgccccagaccgaggacggcaccgtgctgtggccc
ggcgcccggcagcactggcggccgacctcgcccgtcttccgcacgcacgcgctgcgactc
gtgcgggccctcgccgagcgctatcgcgaccatcccgcgatcgtcgcgtggcacatctcc
aacgagctcggctgccacaacctctacgactactccgacgacgccgcggccgccttccgc
acctggctgcgcgaccggtacggcaccctcgacgccctcaacgaggcgtggggcaccgcc
ttctggtcgcagcactacacggagtgggagcagatcctgccgccgcgcacggcgcccacc
caccgcaaccccggccagcgcctcgacttcgagcgcttctcctcggacgccgtgcgcgac
cacctgcgggcggaggccgccgtgctggccgagctcacccccgacatccccttcacgacc
aacttcatggtcgcccagaacgtccgcgacatcgactacccgacgtgggcgggcgacgtc
gacttcatctcgaacgaccactacctgcgcccgggtgagctgggccgcgacgacgtctcc
ttctgggccaacctcacgggcaacatcgccgagggacgcccctggttcctcatggagcac
gcccccagcgccgtcaactggcgcgaggtgaacccgccgaagcgcccgggggagctgatg
cgcgacgccctcacccacgtcgggcacggcgcggatgccgtctgcttcttccagtggcgc
cagtcgcgcgccggaggcgagcgcttccactcggggatggtgccgcacgccggcgagcac
agccgcgtgttccgcgacgtcgccgccctcggcgcgcgactgggggagctcggcgccgtc
acgggctcgcaccgcgagcgcgcgcgcgtcgcgctggtcttcgactacgagtcctggtgg
gtcagcggccgcgactcccacccctccgacgcgctgcgctacgacgacgagaccctcgcc
tggtaccgggcgctgctcgatctcggcgtccgcgccgacgtcgtccccgttgcggcgtcc
ctcgacggctacgacgtcgtcgtcgccccgatgctgcacgtcgtgcccgacgccctgcgg
acacggctcgagcacgtggtgcgaagcgggcgccacctcgtgaccaccgccttctccggc
atcgtcgaccagcacgaccgggtgtggctcggcggctaccccggggcgctgcgggaggtg
ctcggcgtcaccgtcgaggagttcgtcccgcttctggccgacgagacggcgcgactggcc
tccggggccgtcgcgacgcactggagcgagcggatcagccacgtcgccgacgatgtcgag
gtgctcgacacctacgccgcgggcgatctggccgggatgccggcggtcacgcgtcgccgc
gtcggcgccgggtcggccacgtacgtctccgccgacaccggccgtgacggggcgcgcgcg
gtgctggagcgcctcgcgggcgacatcggcgcgctggccggtgaccccctcgccgccgac
ggccgtctcgaggtcatcgtccgcgtcgacgccgcgcgtcgccatgtcttcgtcgtcaac
cgcaccgacgacgaggtcgtcgtggacgatcccgagctcggcgcgctgcgcgtggcgccc
cgcggtgtcgagacgcgcagcatcccggcgcaggagcccgcgctcgccggcgcgcacgga
aggatggacgcatga

DBGET integrated database retrieval system