KEGG   Microbacterium hominis: CXR34_04670Help
Entry
CXR34_04670       CDS       T05238                                 

Gene name
gabT
Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase / 5-aminovalerate transaminase [EC:2.6.1.19 2.6.1.22 2.6.1.48]
Organism
mhos  Microbacterium hominis
Pathway
mhos00250  Alanine, aspartate and glutamate metabolism
mhos00280  Valine, leucine and isoleucine degradation
mhos00310  Lysine degradation
mhos00410  beta-Alanine metabolism
mhos00640  Propanoate metabolism
mhos00650  Butanoate metabolism
mhos01100  Metabolic pathways
mhos01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    CXR34_04670 (gabT)
   00650 Butanoate metabolism
    CXR34_04670 (gabT)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CXR34_04670 (gabT)
   00280 Valine, leucine and isoleucine degradation
    CXR34_04670 (gabT)
   00310 Lysine degradation
    CXR34_04670 (gabT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CXR34_04670 (gabT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:mhos01007]
    CXR34_04670 (gabT)
Enzymes [BR:mhos01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     CXR34_04670 (gabT)
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     CXR34_04670 (gabT)
    2.6.1.48  5-aminovalerate transaminase
     CXR34_04670 (gabT)
Amino acid related enzymes [BR:mhos01007]
 Aminotransferase (transaminase)
  Class III
   CXR34_04670 (gabT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AUG28833
UniProt: A0A2K9DW05
LinkDB All DBs
Position
980551..981918
Genome map
AA seq 455 aa AA seqDB search
MSIIDSAVVGGPTLAQERRLVTSIPGPRSQELLARKSAAVAAGVAHTVPIEAVAAGGGVV
VDADGNSLIDLGSGIAVTSVGNANPRVVAAVQAAVAQMTHTCFMISPYESYVAVAERLNR
LTPGDHEKKSALFNSGAEAVENAIKIARKATGRQAVVAFDHAYHGRTNLTMALTAKSMPY
KSGFGPFASEVYRVPASYPFRDGLSGADAAARAISLIEKQIGADNLAAVIIEPIQGEGGF
IVPAEGFLPAVVDWCRANGVVFIADEVQTGFARTGEMFASDLFGIVPDLITTAKGIAGGM
PLAAVTGRAEIMDATHGGGLGGTYGGNPVACAAALAAMDAFENDGLLERAREIGGILRAR
FESLQGSDARIGDVRGAGAMIAVEFVDPATKAPDAALTAAVAKAAIAQGVIVLTCGTYGN
VIRFLPPLTISDDLLAEGVDVVAAAVAAHAAVAAH
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcatcgacagcgccgtcgtcggcggaccgaccctggcgcaggagcgccgcctc
gtcaccagcatccccggccctcgctcgcaggagctgctggcccgcaagagcgccgccgtc
gccgcgggtgtcgcgcacacggtgccgatcgaggccgtcgccgcgggcggcggggtcgtc
gtggatgccgacgggaactcgctcatcgatctcggcagcggcatcgcggtgaccagcgtc
ggaaacgcgaacccgcgcgtcgtggcggccgtgcaggccgcggtcgcccagatgacccac
acgtgcttcatgatctcgccctacgagtcctacgtcgccgtcgccgagcggctgaaccgg
ctgaccccgggcgaccacgagaagaagtccgcgctgttcaactcgggcgccgaggccgtc
gagaacgcgatcaagatcgcccggaaggcgaccggacgtcaggccgtcgtcgccttcgac
cacgcctaccacggccgcacgaacctgacgatggccctcaccgccaagtcgatgccgtac
aagagcggcttcgggccgttcgcctccgaggtctatcgggtgcccgcgtcctacccgttc
cgcgacggcctgagcggtgcggacgccgcggccagggccatctcactgatcgagaagcag
atcggcgccgacaacctcgccgccgtcatcatcgagcccatccagggcgagggcggcttc
atcgtccccgccgaggggttccttccggcggtcgtggactggtgccgcgcgaacggcgtc
gtcttcatcgccgacgaggtccagacgggcttcgcccgcaccggcgagatgttcgcgagc
gacctgttcggcatcgtccccgacctcatcacgaccgcgaagggcatcgccgggggcatg
ccgctggcggcggtcaccggtcgcgccgagatcatggacgcgacccacggcggcggtctg
ggcggcacgtacggcggcaaccccgtggcctgtgccgccgcgctcgccgcgatggacgcg
ttcgagaacgacgggctgctcgagcgggcacgagagatcggggggatcctccgtgcccgc
ttcgagtcgctgcagggctccgacgcccgcatcggcgacgtccgcggcgccggcgccatg
atcgccgtcgagttcgtcgaccccgccacgaaggcaccggatgccgcgctgaccgcggcg
gtcgccaaagcggcgatcgcgcagggcgtcatcgtcctcacgtgcggcacctacggcaac
gtcatccgcttcctgccgccgctgacgatctcggacgacctcctcgccgagggcgtcgac
gtggtcgccgccgccgtcgccgcccacgccgccgtcgccgcccactga

DBGET integrated database retrieval system