KEGG   Microbacterium hominis: CXR34_09685Help
Entry
CXR34_09685       CDS       T05238                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
mhos  Microbacterium hominis
Pathway
mhos00970  Aminoacyl-tRNA biosynthesis
mhos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CXR34_09685
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mhos03029]
    CXR34_09685
Enzymes [BR:mhos01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CXR34_09685
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CXR34_09685
Mitochondrial biogenesis [BR:mhos03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CXR34_09685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY ComX
Motif
Other DBs
NCBI-ProteinID: AUG29693
UniProt: A0A2K9DYG2
LinkDB All DBs
Position
1998947..2000461
Genome map
AA seq 504 aa AA seqDB search
MAKAALMDFDEALTLYEPVLGFEVHVELNTETKMFSPAGNPAHASNHDAAPNTLVAPVDM
GLPGSLPVVNETAVRFSISLGLALGCQIAPSSRFARKNYFYPDLGKNYQISQYDEPIAFE
GQVEVELTDGTVFEVPIERAHMEEDAGKLTHVGGSTGRIQGAEYSLVDYNRAGVPLVEIV
TKPIFGAEHRAPELAAAYVRAIRDIVLSLGISEARMERGNLRCDANVSLRPRGQEKLGTR
TETKNVNSMRSVERAVRYEIQRQAAILAAGGSITQETRHWHEDTGTTSPGRPKSDADDYR
YFPEPDLLPVAPSTELIESLRADLPEPPAARRRRLKADWGFADIDFQGIVNAGLLTEVDA
TVAAGASPAAARKWWMSEISRLANASGVEPSSLVEPASVAALQQLVDAGTLTDKLARQVL
EGVIAGEGTPQEVVDARGLAVVSDDGALIAAIDEALTAQPDVLEKIRDGKVQAAGAVIGA
VMKAMKGQADAARVRELVLERAAK
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggccgcactcatggacttcgacgaggccctgacgctgtacgagccggtgctc
ggcttcgaggtgcacgtcgagctgaacaccgagaccaagatgttctctccggcgggaaac
cccgctcacgcgtcgaaccacgacgccgccccgaacacgctcgtcgcacccgtcgacatg
ggcctgcccggatcgctcccggtcgtcaacgagacggccgtgcggttctcgatcagcctg
ggtctcgcgctcggctgccagatcgcgccgtcgagccgcttcgcgcgcaagaactacttc
taccccgacctgggcaagaactatcagatctcgcagtacgacgagccgatcgccttcgag
gggcaggtcgaggtcgagctcaccgacggcaccgtcttcgaggtgcccatcgaacgcgcc
cacatggaggaggatgccggcaagctcacgcacgtcggaggctccacggggcgcatccag
ggagccgagtactcgctcgtggactacaaccgtgccggcgtgccgctcgtggagatcgtc
accaagccgatcttcggcgccgagcaccgcgcaccggagctcgccgccgcctatgtgcgg
gcgatccgcgacatcgtgctgtcgctcggcatctccgaagcgcgcatggaacgcggcaac
ctgcgctgcgacgcgaacgtctccctgcgcccgcgcggccaggagaagctcggcacccgc
acggagacgaagaacgtcaactccatgcgctccgtcgagcgcgcggtccgctacgagatc
cagcgccaggccgcgatcctggccgcgggtggcagcatcacgcaggagacgcgtcactgg
cacgaggacaccggtaccacctccccggggcggccgaagtcggatgccgacgactaccgc
tacttcccggagcccgacctgctgccggtggcgccgtccacggagctcatcgagtcgctg
cgcgccgacctcccggagccgcccgccgcacgccgccgccggctgaaggcggactggggc
ttcgccgacatcgacttccaggggatcgtgaatgcggggctcctcaccgaggtcgacgcg
accgtcgccgccggtgcgtctcccgccgcggcgcggaagtggtggatgagcgagatctcg
cgcctcgcgaacgcgtcgggcgtcgagccgtcctcgctcgtcgagccggcctcggtcgcc
gcgctgcagcagctcgtggacgccgggaccctcaccgacaagctcgcccgccaggtgctc
gagggcgtcatcgccggggaggggaccccgcaggaggtcgtcgacgcccgcggcctcgcc
gtcgtctccgacgacggcgcgctgatcgccgcgatcgatgaggcgctcacggcgcagccc
gatgtgctcgagaagatccgcgacggcaaggtccaggccgccggcgccgtcatcggcgcc
gtcatgaaggcgatgaagggtcaggcggacgctgcccgcgtccgcgagctcgtactcgag
cgcgccgcgaagtag

DBGET integrated database retrieval system