KEGG   Microbacterium hominis: CXR34_12775Help
Entry
CXR34_12775       CDS       T05238                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
mhos  Microbacterium hominis
Pathway
mhos00010  Glycolysis / Gluconeogenesis
mhos00030  Pentose phosphate pathway
mhos00051  Fructose and mannose metabolism
mhos00052  Galactose metabolism
mhos00680  Methane metabolism
mhos01100  Metabolic pathways
mhos01110  Biosynthesis of secondary metabolites
mhos01120  Microbial metabolism in diverse environments
mhos01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CXR34_12775
   00030 Pentose phosphate pathway
    CXR34_12775
   00051 Fructose and mannose metabolism
    CXR34_12775
   00052 Galactose metabolism
    CXR34_12775
  09102 Energy metabolism
   00680 Methane metabolism
    CXR34_12775
Enzymes [BR:mhos01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CXR34_12775
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     CXR34_12775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase DAGK_cat Peripla_BP_4
Motif
Other DBs
NCBI-ProteinID: AUG30238
UniProt: A0A2K9DPC9
LinkDB All DBs
Position
complement(2639577..2640605)
Genome map
AA seq 342 aa AA seqDB search
MKIGILTSGGDCPGLNAVIRGVVLKGTTNYNIEFVGIRDGWRGVVDGDFFPLTRHEVKGL
SKVGGTILGTSRTNPYEGPRGGAENIAKTMYGHHIDGIIAIGGEGTLAAANRLWNDGINV
MGVPKTIDNDLRATDYSFGFDTAVNIATDAMDRLRTTGDSHQRCMVAEVMGRHVGWIALH
SGIAAGAHVICIPEVPMSIDEIAAQVQKAHDRGRAPLVVVSEGFTLKGMDEAFSDKGLDA
FNRPRLGGISEVLAPEIERLTGIETRATVLGHIQRGGSPSSFDRVLATRLGLHAADSVYE
QAWGQMVSLKGTDIVRVPFAEALGELNTVPIYRYEEAAALFG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcggcatcctcaccagcggcggagactgccccggactcaacgcggtcatccgc
ggcgtcgtgctcaagggcaccacgaactacaacatcgagttcgtcggcatccgtgacgga
tggcgcggcgtcgtcgacggcgacttcttcccgctcacgcgccacgaggtgaaggggctg
tccaaggtcggcggcacgatcctcggcacgagccgcaccaacccctacgagggtccgcgc
ggcggcgccgagaacatcgcgaagacgatgtacggccaccacatcgacggcatcatcgcc
atcggcggcgagggcaccctggcggccgcgaaccggctctggaacgacggcatcaacgtg
atgggcgttccgaagacgatcgacaacgacctgcgcgccaccgactactccttcggcttc
gacaccgcggtcaacatcgccaccgacgcgatggatcgcctgcgcaccaccggcgactcc
caccagcgctgcatggtggccgaggtcatgggccgccacgtcggctggatcgccctgcac
tccggcatcgccgcgggcgcccacgtcatctgcatcccggaggtgccgatgtcgatcgac
gagatcgcggcccaggtgcagaaggcgcacgaccgcggacgcgcccccctcgtcgtcgtg
tcggagggcttcaccctcaagggcatggacgaggcgttcagcgacaagggcctcgacgcc
ttcaaccgcccgcgtctcggcggcatcagcgaggtgctcgcgcccgagatcgagcgcctg
acgggtatcgagacccgcgccaccgtgctcggccacatccagcgcggcggctcgccgtcg
agcttcgaccgggtgctcgcgacgcgcctggggctgcacgcggccgactcggtctacgag
caggcctggggccagatggtgtcgctgaagggcaccgacatcgtgcgcgtgccgttcgca
gaggcgctcggcgagctgaacacggtcccgatctaccgctacgaagaggccgcggcgctc
ttcggctga

DBGET integrated database retrieval system