KEGG   Microbacterium hominis: CXR34_13240Help
Entry
CXR34_13240       CDS       T05238                                 

Definition
(GenBank) cystathionine gamma-lyase
  KO
K01761  methionine-gamma-lyase [EC:4.4.1.11]
Organism
mhos  Microbacterium hominis
Pathway
mhos00270  Cysteine and methionine metabolism
mhos00450  Selenocompound metabolism
mhos01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mhos00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    CXR34_13240
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CXR34_13240
Enzymes [BR:mhos01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.11  methionine gamma-lyase
     CXR34_13240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cys_Met_Meta_PP DegT_DnrJ_EryC1 Aminotran_5 Aminotran_1_2 Met_gamma_lyase SelA
Motif
Other DBs
NCBI-ProteinID: AUG30316
UniProt: A0A2K9DSR6
LinkDB All DBs
Position
2740609..2741811
Genome map
AA seq 400 aa AA seqDB search
MTRPDRHDAPTTHLDTRAVHAGNRVDPASGAIRTPVVMANSYALPEDPSALDWSGTDVPL
YTRNSGVNQLALQEKLAALEEGEDAVALASGVAALHAVFFTFLRTGDHVVVADVTYEASW
RLFAQLLPEKYGIDATFVDAADPAAVENAIRPETRLIHVETIGNPTTKVTDIAAVARIAH
AAGALLSVDSTFTPPPLYRPLADGADLVVHSLTKFINGHGDAMGGAVIGRRELIQRIKAD
AMVDVGGVISPFNAWLIQRGSVTLPLRLPRHLETAQRLARVLDADPRIAFVAYPGLESHP
QHEIARRQFGGRGFGAVMAFAVDGGPEVQNRFVSHLRVITSAVSLGHDESLIVHIGTGGP
RTLAYPEPFRRYGHLRFSVGLEDARDLEADLLAALDDTFA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtcccgatcggcacgacgcccccacgacccatctcgacacgcgggcggtgcac
gccggcaaccgggtcgacccggcttccggcgcgatccggacgccggtggtgatggccaac
tcctacgcgctgcccgaggacccgtccgccctcgactggtcgggcaccgacgtgccgctg
tacacccggaactcgggcgtcaaccagctcgcgctccaggagaagctcgcggcactggaa
gagggcgaggatgccgtggccctggcatccggcgtcgcggcgctgcacgcggtcttcttc
acgttcctgcgcaccggcgaccatgtcgtcgtcgccgacgtcacctacgaggccagctgg
cggctgttcgcgcagctcctcccggagaagtacggcatcgacgcgacgttcgtggatgcc
gccgatcccgccgccgtggagaacgccatccgccccgagacgcggctgatccacgtcgag
acgatcggcaaccccacgacgaaggtgaccgacatcgccgccgtcgcgcgcatcgcgcac
gccgcgggcgcgttgctgtcggtcgactccaccttcacgccgccgcccctctaccggccg
ctcgccgacggggccgatctggtcgtccactcgctgacgaagttcatcaacggtcacggc
gatgcgatgggcggtgcggtcatcggccgtcgggagctcatccagcggatcaaggcggac
gcgatggtcgacgtcggcggcgtcatctcgcccttcaacgcgtggctcatccagcgcggg
tcggtgacgctgccgctgcgtctgccccgtcacctggagacggcgcagcggctcgcccgc
gtgctggacgccgatccgcgcatcgccttcgtcgcctatccggggctggagagccacccg
cagcacgagatcgcgcgacgtcagttcggcgggcgcgggttcggcgccgtcatggcgttc
gccgtcgacgggggtcccgaggtgcagaaccggttcgtctcccacctgcgcgtcatcacc
tcggccgtctccctcgggcacgacgaatccctcatcgtccacatcggcacgggcggccca
cggaccctcgcgtacccggaaccgttccgccgctacggtcatctgcgtttctcggtgggg
ctcgaggacgcccgcgacctggaggccgacctcctcgccgcgctcgacgacacgttcgca
tga

DBGET integrated database retrieval system