KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_17540Help
Entry
D650_17540        CDS       T02523                                 

Gene name
fabZ
Definition
(GenBank) 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
  KO
K02372  3-hydroxyacyl-[acyl-carrier-protein] dehydratase [EC:4.2.1.59]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00061  Fatty acid biosynthesis
mhq00780  Biotin metabolism
mhq01100  Metabolic pathways
mhq01212  Fatty acid metabolism
Module
mhq_M00083  Fatty acid biosynthesis, elongation
mhq_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D650_17540 (fabZ)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    D650_17540 (fabZ)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mhq01004]
    D650_17540 (fabZ)
Enzymes [BR:mhq01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D650_17540 (fabZ)
Lipid biosynthesis proteins [BR:mhq01004]
 Fatty acid synthase
  Component type
   D650_17540 (fabZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA MaoC_dehydratas 4HBT PS-DH
Motif
Other DBs
NCBI-ProteinID: AGI33023
LinkDB All DBs
Position
1697203..1697661
Genome map
AA seq 152 aa AA seqDB search
MTTENREPNIIEVTEIMDMLPHRYPFLLVDRVTDYEEGKWLKAIKNVTFNEPCFTGHFPG
APIFPGVLILEAMAQATGVLAVATYGKLSEDELYYFAAIDNARFKRPVVPGDQLQLEVEF
LKEVRGITKFTGKAYVDGKLVCEADLMCARRK
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgacaactgaaaatcgtgagccaaatattattgaagtaaccgaaattatggatatgtta
ccgcatcgctaccctttcctgttagttgatcgcgtaaccgattatgaagaagggaaatgg
ttaaaagccattaaaaatgtaaccttcaatgaaccttgttttaccgggcattttcctggc
gcaccaatcttcccaggagtattgattctggaagcaatggctcaagcaactggcgtatta
gccgttgccacttatggtaagttaagtgaagacgaactctactattttgccgcaattgac
aatgctcgctttaagcgaccggttgtgccgggcgatcaacttcaacttgaggttgaattt
cttaaagaagtacgtggtattactaaatttaccggtaaagcatacgttgatggcaaatta
gtctgtgaagcagatttaatgtgcgctcgccgtaaataa

DBGET integrated database retrieval system