KEGG   Mannheimia haemolytica USDA-ARS-USMARC-183: D650_510Help
Entry
D650_510          CDS       T02523                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase/oxidase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
mhq  Mannheimia haemolytica USDA-ARS-USMARC-183
Pathway
mhq00564  Glycerophospholipid metabolism
mhq01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mhq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    D650_510
Enzymes [BR:mhq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     D650_510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 NAD_binding_8 HI0933_like GIDA Pyr_redox_3 Pyr_redox_2 YbjQ_1 Thi4 FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AGI31325
LinkDB All DBs
Position
complement(43071..44666)
Genome map
AA seq 531 aa AA seqDB search
MKRHEQLAQVQQTQKWDFIIIGGGASGLGIAVDAASRGYKTLLLESHDFAKGTSSRSTKL
VHGGVRYLANGDVALVREALRERGRLAKNAAHLFKNQSFIIPNYKFKDCVMYRVGLGLYD
MLSGNLSLGKTENISKTEAKRRLPTLNDTGLRTGTVYQDGQFDDSRLAVNMAQTVVEHGG
TVLNHAKVTSLHKTPQGKIDGVTFYDELNQQEHTVFGTAVINATGVFMNDILSMDHGSTK
KFVVPSQGIHLVLDKSFLPSNDALMIPKTSDGRVLFAVPWHEVLVVGTTDTLIENPSYEP
IPLEQEVNFILETAAQYLTKKPTRDDVKAVFAGQRPLAAPEKEGQSTKEVSRSHKVLTDA
TSGLITITGGKWTTYRQMAEDTVEEALKVHSELGNKPCVTVNLPIHGNIPAAQVNLQDHL
YVYGSDIPQLRALMTETPEYAQKIHPRLDYTVAEVIWAVRHEMAQTVEDVLARRVRLLFT
DARAAIDSAAKVAAIMAKELGKDEMWQQQQVIQFLDVAKHYLLVDYQPQPI
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagacatgaacagctagctcaagtacaacaaacgcaaaaatgggattttattatt
atcggtggtggcgcaagtggtttggggattgcggtagatgcagcttcccgtggctataaa
accttattattagaaagccatgactttgcgaaaggtacatcgagccgaagcacaaaatta
gtccacggtggcgttcgctatcttgcaaatggcgatgttgcactcgtgagagaagcattg
cgtgaacgaggtcgtttagctaaaaatgcagctcatttatttaaaaaccaaagctttatt
attccaaactacaaattcaaagactgtgtaatgtatcgtgttggtttaggcttatacgat
atgctttcaggcaacctgagtttaggaaagactgaaaacatcagtaaaactgaagcgaaa
agacgtttaccaaccttaaatgatactggtttacgtacaggcactgtttatcaagatggg
caatttgatgactcacgtcttgcagtgaatatggcacaaacggtagtagagcacggcggt
acagtactaaatcacgccaaagtgacttcactgcacaaaacgccacaaggcaaaattgat
ggggtgactttctacgatgaactcaatcaacaagaacatactgttttcggcactgcggtg
attaacgcaaccggcgtatttatgaatgatattttaagtatggatcacggtagcacgaaa
aaatttgtcgtaccaagccaagggattcacttagtattagataaatcattcttaccaagt
aatgatgcgttaatgattccaaaaacctctgacggacgagtgttatttgctgtaccttgg
cacgaagtgttagtcgtagggacaacagatactctgattgaaaatccttcttatgagcca
attccattggaacaagaggtgaactttattttagagacagccgcacaatatctgacaaaa
aaaccaactcgtgatgatgtaaaagcagtctttgccggtcaacgtccgcttgcggcaccg
gaaaaagaaggtcaaagcactaaagaagtatctcgtagtcacaaagttctcactgatgca
accagcggtttgattacgattacaggtggtaaatggacaacttatcgtcaaatggcagaa
gataccgtagaagaagcgttaaaagtccactctgaactaggcaataaaccttgtgtgacc
gtcaacttaccgattcacggtaatattccggcagcacaagtgaatctacaagatcatcta
tatgtatatggctcagatattccacagttacgcgccttaatgactgagaccccggaatat
gcacaaaaaatccatccgagactagattataccgttgcagaagtgatctgggcagttcgc
cacgaaatggcacaaacggttgaggatgtattagctcgccgtgttcgtttgctcttcact
gatgcgagagcggcgattgatagtgcagcaaaagtggctgctattatggcgaaagaatta
ggtaaagatgaaatgtggcaacaacagcaagttatccagttccttgatgttgcgaagcac
tatttattggtagattatcagccacagccaatctaa

DBGET integrated database retrieval system