KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_20830Help
Entry
D648_20830        CDS       T02522                                 

Definition
(GenBank) acetylornithine deacetylase
  KO
K01438  acetylornithine deacetylase [EC:3.5.1.16]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
mht00220  Arginine biosynthesis
mht01100  Metabolic pathways
mht01110  Biosynthesis of secondary metabolites
mht01130  Biosynthesis of antibiotics
mht01210  2-Oxocarboxylic acid metabolism
mht01230  Biosynthesis of amino acids
Module
mht_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:mht00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    D648_20830
Enzymes [BR:mht01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.16  acetylornithine deacetylase
     D648_20830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M42
Motif
Other DBs
NCBI-ProteinID: AGI36086
LinkDB All DBs
Position
complement(452323..453465)
Genome map
AA seq 380 aa AA seqDB search
MKQIPFIQRYAQLIELPTISSLVAEEDLSNRRLIELLATWLADFGFKTEILAVEGSRNKY
NLLATYGEGEGGLLLAGHTDTVPFDEGKWRFNPFQLTEKAGKLYGLGTADMKGFFAFVVE
VVSQLDLTQIKKPIRILATADEETTMLGARTFAQHSHIRPDCAIIGEPTSLKPIRAHKGH
IGESVRITGRSGHSSDPAKGINAIELMHQSIGYLMKMRDELREKYHNPLFQVTHPTMNFG
NIHGGDAINRICACCELQFDMRPLPNMAVQDLYAMVNEHLKPMLEQYGDLIEIRHLHDGI
PGYECEHSAQIVQVVEKLLGEKCDAVNYCTEAPFIQQLCPTLVLGPGSIEQAHQPDEFLE
MKYIEPTKELLTKLIYHFCG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagattccctttattcaacgctatgctcaactgattgagctaccgaccatttcc
agccttgttgccgaagaagatttatcgaaccgccgtttgattgaattgctcgccacttgg
ctggcagatttcggctttaaaaccgagattttagcggtagaaggcagccgtaataaatac
aatttacttgcgacctatggcgagggtgagggcggcttattattggcagggcataccgac
accgtgccgtttgatgaaggaaaatggcgcttcaatccattccaattaaccgaaaaagca
ggcaaactctacggcttaggcacggcagatatgaaaggctttttcgcctttgtggtggag
gttgtgagccaactcgacctaacccaaatcaaaaagccgattcgcattcttgccaccgct
gatgaagaaaccacaatgctgggggcaagaacctttgctcagcacagccacattcgcccc
gattgtgcgattattggcgagccgacctcgctcaaaccgattcgagcccacaaagggcat
attggcgaatcggttcgcattaccggcagaagcggacactccagcgaccccgccaaaggc
attaatgcgattgaattaatgcaccaatctatcggttatttaatgaaaatgcgtgatgaa
ctgcgagagaaataccacaatccgctgttccaagtcacccacccgacaatgaacttcggc
aatattcacggcggcgatgccattaaccgcatttgtgcctgttgcgaattgcaatttgat
atgcgaccactaccgaatatggcggtgcaagatttgtatgcaatggtaaacgagcattta
aaaccgatgctggaacaatatggcgatttaattgaaatccgccatttacacgatggaatt
ccgggctacgaatgcgaacactcggcacaaatcgtgcaagtggttgaaaagctactgggc
gaaaaatgcgatgccgtcaattactgcaccgaagccccattcattcaacaactctgccca
acgctggtactaggccccggctccattgaacaagcccaccagcccgatgagtttttggaa
atgaaatatatcgaaccgacaaaagagttattgactaaattgatttatcatttttgtgga
taa

DBGET integrated database retrieval system