KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_24170Help
Entry
D648_24170        CDS       T02522                                 

Definition
(GenBank) bifunctional 3-hydroxydecanoyl-ACP dehydratase/trans-2-decenoyl-ACP isomerase
  KO
K01716  3-hydroxyacyl-[acyl-carrier protein] dehydratase / trans-2-decenoyl-[acyl-carrier protein] isomerase [EC:4.2.1.59 5.3.3.14]
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
mht00061  Fatty acid biosynthesis
mht01100  Metabolic pathways
mht01212  Fatty acid metabolism
Module
mht_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:mht00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    D648_24170
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:mht01004]
    D648_24170
Enzymes [BR:mht01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.59  3-hydroxyacyl-[acyl-carrier-protein] dehydratase
     D648_24170
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.14  trans-2-decenoyl-[acyl-carrier protein] isomerase
     D648_24170
Lipid biosynthesis proteins [BR:mht01004]
 Fatty acid synthase
  Component type
   D648_24170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FabA DUF5608
Motif
Other DBs
NCBI-ProteinID: AGI36418
LinkDB All DBs
Position
133144..133674
Genome map
AA seq 176 aa AA seqDB search
MNSCTPIIKPSYTYEELLLSGKGELFGEKGPQLPAPPMLMMDRIIEMNQEKGNFEKGYIE
AEFDIKPDLWFFNCHFINDPVMPGCLGLDAMWQLVGFYLGWIGGEGKGRALGVGEVKFTG
QILPTAKKVTYRIHMKRVVNRKLVMGVADGEVEVDGRVIYTATDLKVGLFQDTTAF
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaacagttgtacaccaattatcaaaccaagctatacttacgaagagcttttgctatca
ggaaaaggagaattattcggtgaaaaagggcctcaattgccggctccaccgatgttaatg
atggatcgcatcattgaaatgaaccaagaaaaaggcaattttgaaaaagggtatattgaa
gctgagtttgatattaaaccggatttatggttttttaactgccattttattaacgatcct
gtaatgccgggttgcttaggcttagatgcgatgtggcaactggttggtttttatctcggc
tggattggtggcgaaggcaaagggcgtgcattgggcgtaggtgaagtaaaattcaccgga
caaattttaccgacagcgaaaaaagttacttaccgtatccatatgaaacgtgtggtcaat
cgtaagttagtgatgggggttgctgatggtgaagtcgaagtggacgggcgagtgatctat
actgctactgatttaaaagtaggcttattccaagatacgacagcattctaa

DBGET integrated database retrieval system