KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_4560Help
Entry
D648_4560         CDS       T02522                                 

Definition
(GenBank) two-component system response regulator ArcA
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
mht02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mht00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    D648_4560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:mht02022]
    D648_4560
Two-component system [BR:mht02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   D648_4560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C
Motif
Other DBs
NCBI-ProteinID: AGI34461
LinkDB All DBs
Position
2093190..2093912
Genome map
AA seq 240 aa AA seqDB search
MKIPQILIVEDELVTRNMLKSIFEGEGYQVFQASNGEEMHSVLSTNEINLVLMDINLPGK
NGLILAREIRENMKLPLMFLTGRDNEIDKILGLEIGADDYITKPFNPRELTIRARNLLQR
TMIDKENDVVKEQSEIESYRFNGWILDINSHSLISPEGEVNKLPRSEFRALLHFCQHPGK
IQTREDLLKKMTGRELKPHDRTVDVTIRRIRKHFEDHPNTPEIIVTIHGEGYRFCGNIEP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcccacaaatcttaattgttgaggatgagttagtaacaaggaatatgctgaaa
agcatttttgaaggagaaggatatcaggtatttcaagcatctaacggcgaggaaatgcac
tctgttctgagtacaaatgaaatcaatcttgtgctaatggacattaacttaccgggaaaa
aatggattaattctcgcccgagaaattcgagagaatatgaagctaccattaatgttttta
accggtcgcgacaatgaaattgataagatcctcggtttagaaataggtgccgatgactat
atcactaaaccgtttaatcctcgagaattgactatccgagcgagaaatttattgcaacga
acgatgatagataaagaaaacgacgttgtaaaagagcaatctgaaattgaaagctatcgc
tttaacggttggatcttagacattaacagtcatagtttaatctcaccagaaggtgaggta
aataaattaccacgtagtgaatttagggctttattacatttttgccaacatcctggaaaa
attcaaacacgtgaagatttattgaaaaaaatgaccgggcgggaactaaaacctcatgat
agaaccgttgatgttactattcgccgtattcgtaaacattttgaagaccaccccaatacc
ccagaaattattgtcaccattcacggtgaaggctaccgtttctgtggtaacatcgaacct
taa

DBGET integrated database retrieval system