KEGG   Mannheimia haemolytica USDA-ARS-USMARC-185: D648_7100Help
Entry
D648_7100         CDS       T02522                                 

Definition
(GenBank) hypothetical protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
mht  Mannheimia haemolytica USDA-ARS-USMARC-185
Pathway
mht02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:mht00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    D648_7100
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mht02000]
    D648_7100
Transporters [BR:mht02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    D648_7100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1
Motif
Other DBs
NCBI-ProteinID: AGI34714
LinkDB All DBs
Position
1823674..1824711
Genome map
AA seq 345 aa AA seqDB search
MNVLKLISLKSILIASGIFLSAQAAQAEGRLTVYCSVQNNVCEEMTKQFSHKYNVETKFI
HGGTGTIFGKVKAEASNPQADIWYGGTIEPHFQAGELGLLEAYRSPKQAEILPQFKSLVE
SEQGKFTSIVYMLVLGLGVNTEKLAKLGIEAPKKWEDLSDPRLKGEVQLPDPRSSGTTYT
FMTTLSTLWGEEKTFDYLKKLNNNVSQYVKSTLVTSNLARGESAVTVGFVHSYATEKEKG
APIEAIIPEGKVGYALGGVSIIKNARNLDNAKLFMDWVLSKEAQEIPWKKHGVYQTPTNI
NAEVAPQSTKAEALDFVEIDYQKAGSSEEGKRLIDKWLAEIKLAN
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtactcaaattaatctcattaaaatcgatcttaatcgcctctggcattttctta
tcagctcaagcagcacaagcagaaggtcgtttaactgtttattgctcggtacaaaataat
gtttgtgaagaaatgaccaagcaattttcacacaaatataatgtcgaaactaaattcatt
cacggcggaaccggtacaattttcggaaaagtaaaagcggaagcatcgaaccctcaggca
gatatttggtatggcggcacgattgaacctcactttcaagcaggcgaattaggcttactg
gaagcctaccgttcaccaaaacaagctgaaattctgccacaatttaaatccttagttgaa
agtgaacaaggtaaatttacctctatcgtttatatgcttgtattagggttaggcgtgaat
accgaaaaactcgccaaactaggcattgaggcaccgaaaaaatgggaagatttatcagat
cctcgcttaaaaggtgaagtacaactgcctgatcctcgtagctccggcacgacttatacg
tttatgaccactctttcaaccttatggggcgaagagaaaacctttgattatctgaaaaaa
ctcaacaataacgtttcgcaatatgtgaaaagcaccctagtcaccagcaatcttgctcgt
ggtgaaagtgcggttacggtaggctttgtacatagttatgccactgaaaaagaaaaaggt
gcgcctattgaagccattattccggaaggtaaagtgggctatgcgttaggcggtgtcagc
attatcaaaaatgcccgtaatttagataacgccaaactctttatggattgggtgctttca
aaagaagcacaggaaattccttggaaaaaacacggtgtttaccaaaccccaacaaacatc
aacgccgaagttgctccacaatcaaccaaagccgaagcgttagactttgtggaaattgat
taccaaaaagcaggttccagcgaagagggcaaacgcttaattgataaatggttggcggaa
attaaattagcaaactag

DBGET integrated database retrieval system