KEGG   Methanospirillum hungatei: Mhun_3049Help
Entry
Mhun_3049         CDS       T00325                                 

Definition
(GenBank) glutaredoxin
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mhu  Methanospirillum hungatei
Brite
KEGG Orthology (KO) [BR:mhu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Mhun_3049
Enzymes [BR:mhu01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Mhun_3049
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Glutaredoxin Pyr_redox FAD_binding_2 Thi4 NAD_binding_8 FAD_oxidored GST_N_3 GIDA HI0933_like DAO FAD_binding_3 Lycopene_cycl PALP FMO-like DUF836 Thioredoxin_2 Trp_halogenase GP3
Motif
Other DBs
NCBI-ProteinID: ABD42736
UniProt: Q2FT67
LinkDB All DBs
Position
3321496..3322671
Genome map
AA seq 391 aa AA seqDB search
MTDTYLSHMPEVTVYSTQNCPYCRLAKAFLDRNNIPYRSVDVGIDRKAAKEMVELSGQYG
VPVIVAGEEVIVGFDTDKLRALFTTGKKPDMFDVIIVGAGPAGLTAALYCVRKNLKTLMI
SPDIGGQALESWNIENYMGYRMITGDDLMAKFEEQIRELEIRIELDQVNSLLPTSGGFSV
KTVSDQEYKGKTIILSQGKKPRKLGVAREEEFIGRGLSVCATCDGPIFKEKVVGVVGGGN
SALTTALEMSGIAKEVHLIVRSSIRADAVYTSQYAQKQNIITHTGYEVTELIGDDRLSGI
IITNRETGEKKTLKLDGLFTEIGWIPNTSFVEGLLKLNDQKEIVIDINCRTSAPGIFAAG
DVTSIAGKQIIIACGEGAKAALSAFDYLMTQ
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacacatacctatctcatatgccagaggtcacggtctattcaactcagaactgt
ccatactgccggcttgcaaaagcgtttttagacagaaataatattccataccgctcggta
gatgtgggaattgaccggaaagcagccaaggagatggttgaactctcaggacaatatggg
gttccggtcatcgttgcaggtgaggaggtcatcgtcggattcgatacagacaaactcagg
gccctgtttaccaccggaaaaaagccggatatgtttgatgtgattattgtcggtgcaggc
cctgcaggcctgactgctgcgttatactgtgtcaggaagaatctgaaaacgcttatgata
tcaccggacatcggaggtcaggctcttgagagctggaatattgagaattacatgggatac
cggatgatcaccggtgatgacctgatggcgaagtttgaagagcagatccgggaactggag
atcaggattgaacttgatcaggtcaactctcttctcccgaccagtggcggattctcggtg
aaaaccgtatcagaccaggaatataaaggaaaaacaataatcctttcccagggaaaaaag
ccaagaaaactcggtgtggcaagagaagaggagttcatcggaaggggtctttcagtctgt
gcaacatgtgacgggccgatctttaaagagaaggtggttggagttgtcggtggggggaac
tcagcgcttacgactgcacttgagatgagtggtattgcaaaagaagtgcatctcattgtc
cggagcagcattcgggctgatgcagtgtacacctcacaatacgcgcaaaagcagaacatc
atcacccataccggatatgaagtgaccgaacttatcggagatgaccggctttcaggcatt
attattacaaaccgggagaccggtgagaagaagaccttaaagcttgacggattgttcacg
gagataggatggattccaaatacttcctttgttgagggattgctcaaattaaatgatcag
aaagagattgtgatagatattaactgccggaccagtgctcctggtatatttgctgccggg
gatgtcacctcaattgcaggaaaacagatcatcattgcctgtggtgaaggggcaaaagca
gctctttcagcatttgactatctgatgacacagtag

DBGET integrated database retrieval system