KEGG   Mycoplasma hyorhinis DBS 1050: Q453_0152Help
Entry
Q453_0152         CDS       T02927                                 

Definition
(GenBank) hypothetical protein
Organism
mhv  Mycoplasma hyorhinis DBS 1050
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Spermine_synth DUF1896 SID-1_RNA_chan
Motif
Other DBs
NCBI-ProteinID: AHA40905
LinkDB All DBs
Position
164088..164600
Genome map
AA seq 170 aa AA seqDB search
MKNKKKINLYSIKILGLIFSIPSISALTIACDFNAINKIKSNKFANKDKVDSSDILTSNL
ENTLSETTNLSRPKSDDSTNNSTIKQDDNITNITDSDEENKNLFEGLNFDQVNKLLQEQR
IISQEKKEFFENKILKNINKNFKEYQKKYFMNSYWLHREMLKFLDKQIKT
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaataagaaaaaaataaatttatattctataaagattttgggcttaatattttca
atcccatctataagtgctttaacaatagcgtgtgactttaatgctataaataaaattaaa
tctaataaatttgctaataaagacaaagtggactcttctgacattctcacttctaatcta
gaaaatacattatctgagactacaaatctttcccgcccaaagtcagatgattcaactaat
aatagcactataaaacaagatgataatataacaaatattacagattcagatgaggaaaat
aaaaatctatttgaaggactaaattttgatcaagtgaataaattacttcaagaacaaaga
ataatctcacaagagaaaaaagaattttttgaaaataaaattttaaaaaatattaataaa
aattttaaagaatatcagaaaaagtattttatgaattcatattgacttcatagagaaatg
cttaaatttttagataaacagatcaagacttaa

DBGET integrated database retrieval system