KEGG   Megasphaera hexanoica: ACT01_00340Help
Entry
ACT01_00340       CDS       T05536                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
mhw  Megasphaera hexanoica
Pathway
mhw00473  D-Alanine metabolism
mhw00550  Peptidoglycan biosynthesis
mhw01100  Metabolic pathways
mhw01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    ACT01_00340
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    ACT01_00340
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    ACT01_00340
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhw01011]
    ACT01_00340
Enzymes [BR:mhw01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     ACT01_00340
Peptidoglycan biosynthesis and degradation proteins [BR:mhw01011]
 Precursor biosynthesis
  Amino acid ligase
   ACT01_00340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 GARS_A RimK ATP-grasp_3 ATP-grasp ATP-grasp_4 ATPgrasp_ST TTL
Motif
Other DBs
NCBI-ProteinID: AXB80815
UniProt: A0A344MFX6
LinkDB All DBs
Position
complement(65771..66709)
Genome map
AA seq 312 aa AA seqDB search
MDTLQDKNIAVIVGGPSTEAEVSRRTGAAIAGALQEKGYHAELLELVPDKLASQLQDKNI
DIVFNALHGHYGEDGVLQGLCEMMGIPYTGPGVMASAVGMNKVMSKCAFQGAGIATAPFA
YYFNTQDEDAIAADIIRRFSLPVVIKSAGQGSSIGTVIVHSEDEIRSALNEAFKYSNSIV
AEAFIDGDEFTVAVMDDMAFPVIQIVSSTGKYDYYSKYAPGVAKHLCPAPISPELTKKMQ
NLALDVFHLCHCSGISRVDIMTDKEGNPFVLEINTVPGMTATSLVPDAARAAGIEFPDLC
ERILKEASVGKF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atggacacactgcaggataagaatattgccgttattgtaggcggaccttcaacggaagcg
gaagtatcgcgccgtacaggagctgccattgccggagcactgcaggaaaaggggtatcat
gcggaacttctggaactggtgccggataagcttgccagtcagctgcaggataagaatata
gatattgtttttaatgcgcttcatggacattacggagaagatggtgtattgcagggatta
tgtgaaatgatgggaattccctataccggtccgggcgtcatggccagtgccgtcggtatg
aataaggtcatgagcaagtgcgcgtttcagggagcgggaattgcaacagcaccctttgcc
tattatttcaatacgcaggacgaagatgctatcgctgctgatattatcagacggttttct
ctgcctgtagtcataaaatcggcagggcaggggtccagtattggtacggtaatcgttcat
tcagaagacgaaatacgaagcgcattgaacgaagcgtttaagtacagcaattctattgtg
gctgaagcattcatcgacggggatgagtttactgttgctgtcatggatgatatggccttt
cccgtcattcaaattgtttccagtacaggaaaatatgactattattccaagtatgctccc
ggcgtagcaaaacatctctgtccggcacctatttcgccggaactgacaaaaaagatgcag
aatctggctttggacgtatttcatctttgccattgcagcggtatttcccgcgttgatatc
atgacggacaaagagggaaatccctttgtactggaaatcaacacggttccgggcatgacg
gcgaccagtctggtccccgatgcggcccgtgcagcaggaatagaatttcccgatttatgt
gaacgcattctaaaggaagcatctgtcggaaaattttag

DBGET integrated database retrieval system