KEGG   Megasphaera hexanoica: ACT01_03450Help
Entry
ACT01_03450       CDS       T05536                                 

Definition
(GenBank) alcohol dehydrogenase
Organism
mhw  Megasphaera hexanoica
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2
Motif
Other DBs
NCBI-ProteinID: AXB81371
UniProt: A0A344MHI2
LinkDB All DBs
Position
750685..751713
Genome map
AA seq 342 aa AA seqDB search
MRAGFIEKPMKAYFINDAPEPQLERDTDVKIQVRATGICGSEVHAYHGKHPWRVPPVVSG
HEFSGVVVETGSAVTTCRPGDRVTAEPQYGCGHCYLCQSGRYNLCPEKKILGASGWSGSF
GEYVVLPQQCIVPLPDAVSFAEGALIEPLAVGMHAVRAHHVQETTKVAVIGCGTIGLGVV
LSAACFHPAALFGIDVIDFNLEKARSMGAVAAFNSTRDDVVKEIMERTDGKGVDITFLAF
GNDACVRQAAEITRPGGTISEIAIMGKDIKASFDLIQVKELHVDGSNMYVRSDYEAVLAE
IAAGNMKPSGFITKRFPITQFGEALEFTDKRPEPVVKTLLEF
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgcgagcaggatttatagaaaaaccgatgaaagcctactttatcaatgacgcaccggag
cctcagttggaacgggatacggatgtcaaaatccaggtccgggcgacgggcatctgcggt
tctgaagtacatgcttatcatgggaagcatccctggcgggtgccacccgtcgtatcaggc
cacgaattttccggggtcgtcgtcgaaacgggcagcgccgtaacgacgtgccggcccggt
gacagggtgacggccgaaccacaatatggctgtggccattgttatttatgccagagcggg
cggtataatctgtgcccggaaaagaagatactcggcgcttccggatggagcggatcgttt
ggtgagtacgtcgttctgccccagcaatgcatcgtaccgttgccggacgccgtatccttt
gccgaaggggcgctcattgaaccactggcggtcggcatgcatgccgtacgggcgcatcat
gtacaggagacgacaaaggtggccgtcatcggctgtggtacgataggactgggtgtcgtt
ctcagcgcggcttgttttcatccggcggccctttttggcatcgacgtcatcgattttaat
ttggaaaaagcccgctccatgggagctgttgctgcgtttaacagcacgcgcgatgatgtc
gtcaaagaaattatggaacggaccgatggtaagggcgtcgatatcaccttcctggccttc
ggtaatgatgcctgcgtccgtcaggcggcggaaattacccgtccgggcggcacgatttcg
gaaatcgccatcatgggtaaggatataaaggcttcgtttgaccttatccaggtgaaagag
ctgcatgtggacgggtccaatatgtatgtccgtagtgactatgaagctgtattggcagaa
attgcggcaggcaatatgaagccctcagggtttattacaaaacgcttccccattacccag
tttggtgaagccctggaatttacggataagcggccggaaccggtcgtaaagacacttctg
gaattttag

DBGET integrated database retrieval system