KEGG   Megasphaera hexanoica: ACT01_07845Help
Entry
ACT01_07845       CDS       T05536                                 

Definition
(GenBank) kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mhw  Megasphaera hexanoica
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mhw01001]
    ACT01_07845
Enzymes [BR:mhw01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ACT01_07845
Protein kinases [BR:mhw01001]
 Serine/threonine kinases: Other
  Bacterial family
   ACT01_07845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like APH Kdo RIO1 FlgT_N PIP49_C Phage_term_smal
Motif
Other DBs
NCBI-ProteinID: AXB82155
UniProt: A0A344MJR6
LinkDB All DBs
Position
1677223..1679145
Genome map
AA seq 640 aa AA seqDB search
MIGHILDNRYKILEKVGSGGMASVYKAQDILLDRIVAVKVLHSKYASDHDFVVRFRQEAQ
AAAKLSHPNIVNIYDVGYDENAHYIVMEYVRGETLKEYIEKHGHLPINTSIQITFDIGEA
LEHAHANGIVHCDIKPHNILVTETGRIKVADFGIARAINSSATNKGDNSVLGSVHYFSPE
QASGGKIDERTDIYSLGVVMYEMMTGVVPFEGDTAISVALQHVQDDIPLPSKYNRRIPQL
VERCILKAMAKNPDDRFQSVTEMMSELRMAQGFVNTNKAKGAPPIIKNNFNTQKIQPMKD
RQEPKRKGFFARFVDSISNHSKKSIVIGMMIVFVATFAWAFFSFGNFWSTENITVPDVTG
KQVEIAKNILKKKNLDVSVKEVESSDVPIGEVISQTPSGGAVVKAQRTIHLTVSKGNKGE
EVLIPDLKGLTMDEAEKILKEIGLSIGKVKYESSDSVENGHIISQNPKSPDKVEKGTKIN
LVICRKNSDETKPSKALPDTSGMSLDAAIKALQDAGYNVGNISNLDSSKDQSQAKVTSQS
QQGDSVDLSVEYPSAAPAADPNANNQEQAGTTHTGMVNISVPSGASSQHVQIVVSDDNGS
RVVYDRNQSGGDSISKSVSGTGRTRVKVYINNSLVQDQYI
NT seq 1923 nt NT seq  +upstreamnt  +downstreamnt
atgattggtcatatcttagacaatcgatataagatattggaaaaagtgggtagcggcggc
atggccagcgtgtacaaggcacaggatattctcctggaccggattgttgcggtcaaagtc
ctgcatagcaaatatgccagcgaccatgatttcgtcgtgcgcttccgtcaggaagcccag
gcggcagctaaattatcccatcccaatattgtaaatatatacgacgtcggctacgacgaa
aacgcgcattatattgtcatggaatacgtgcgcggtgaaacactgaaagaatatattgaa
aagcacggccatctgccaatcaatacgtcaatccagattaccttcgacattggtgaagca
ttggagcatgcccatgcgaacggaattgtccactgtgatatcaaaccgcacaatatcctg
gtgacagaaacgggacgaatcaaagtggccgattttggcattgccagagcgattaattcc
agtgcgaccaacaaaggggataactcggttctgggatcggtccattatttttcacctgaa
caggccagtggtggaaaaatcgatgaacggacggatatttattctcttggcgtcgtcatg
tatgaaatgatgaccggtgtcgttccttttgaaggagacacggcaatcagtgtggctctg
cagcatgtgcaggatgatatcccgctgccaagtaaatacaaccgccggattccccagctg
gtagaacgatgcattctgaaggccatggccaaaaatcctgacgaccggtttcagtccgta
acggaaatgatgtcggaactgcgcatggcccagggatttgtcaatacgaataaagccaaa
ggcgcaccgcctattattaaaaacaatttcaatacgcagaaaatacagccgatgaaggac
cggcaggaacccaaaagaaaaggcttttttgcccggttcgtcgattctatcagcaatcat
tccaaaaaatctatcgtcattggaatgatgattgtatttgtagcgactttcgcctgggcc
tttttctccttcggtaatttctggagtacagaaaatatcaccgttcctgatgtgacaggg
aaacaggtagaaattgccaagaatatattgaagaagaaaaatctcgatgtgtctgtcaag
gaagtcgaaagttcagatgtgccgattggtgaggtcatcagccagacgccgtcaggcggt
gctgtcgtcaaagcccagcggacaatccatctgacggtcagcaagggcaataagggagaa
gaagtcctgattccggacctgaaagggctgacgatggatgaggcagaaaagattctgaaa
gaaatcggtctttccatcggcaaggtcaagtatgaatccagtgattctgtcgaaaacggc
catatcatcagccagaatcccaaatcacctgataaagtagaaaagggaacgaaaatcaac
ctcgtgatctgccgcaagaacagtgatgaaacaaaaccgtccaaggcactgcccgatacg
tctggcatgagtctcgatgcggccatcaaagccttgcaggatgccggttataatgtaggt
aatatttctaatctcgacagctcgaaagaccagagccaggctaaagtcaccagtcagtcc
cagcagggggattctgtcgatttgtctgtcgaatatccgtcggcggcaccggcagctgat
cccaatgccaacaatcaggaacaggccggaacgactcatacgggcatggtcaatatcagc
gttccatccggtgcttccagtcagcatgtccagattgtcgtcagtgatgacaacggatcc
cgtgtcgtctatgaccggaaccagtctggcggggatagtatcagtaagagcgtcagcggt
acaggccggacgagagttaaggtatatatcaataattcactggttcaggaccagtacatt
taa

DBGET integrated database retrieval system