KEGG   Megasphaera hexanoica: ACT01_09645Help
Entry
ACT01_09645       CDS       T05536                                 

Definition
(GenBank) hypothetical protein
  KO
K21449  trimeric autotransporter adhesin
Organism
mhw  Megasphaera hexanoica
Brite
KEGG Orthology (KO) [BR:mhw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhw02000]
    ACT01_09645
Transporters [BR:mhw02000]
 Other transporters
  Pores ion channels [TC:1]
   ACT01_09645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Collagen ESPR YadA_anchor YadA_stalk YadA_head ATG16
Motif
Other DBs
NCBI-ProteinID: AXB82477
UniProt: A0A344MKN8
LinkDB All DBs
Position
complement(2039838..2047943)
Genome map
AA seq 2701 aa AA seqDB search
MNKIFKVIYSKTRHCYVVVSELAKSHCKTTQSHTARSKTALTAAVLLALGAFSFVGMPVV
QAADGTESLRNNDFVGANDQYWYYDEDKGEWTTYQYKLTSAFNNRARGKLPNYQGGGAKF
PGAVTAGLYAQAGQQTVTIGDRNAGQSKGSVFIGEHSGYNNGNNDPAGMKNNYVTSVGFQ
SDATGWGSIAIGSNATAENSKMESQVVKEVGNANTSGTVSDDTYGIEENPTIQGASVALG
YNAHSKDGNIAIGSYSDATSTDKNDSYVSVGNANLKRRITNVAKGTDNSDVVTVGQMNDA
IKQADNLNVNAGWGINVADENDPTNTGKGTKNVISLKHNLGTGYNDDEANGMIIGGLVED
RDPAKQYGAADANSVIVGAGKALASGKSSVVVGGLDNVASGATSVVVGGDNNNAAGNQSA
VFGGRDNTAAGIASTAGGGIMNVANGQQAVALGGAYNYALGTSSTAIGGTGGNGMYGYST
SVNGNYSVSLAGGSTGTDALNGLAAGNQSVVTTANGTAVGYQATTDKEGTIAFGHDAGDV
SGYAVTWKKRTDGKTNADHTTNDYTQVPDSVTPTTYKDAYYNRLVKVADGQDAHDVVVME
QLTKATNDLTKDLSVNAGWGINVADEKDTTGKVTKNVISLNRNLGTNYGNPWKGEGKVTF
EAGGENSMILGGAASILFNNEGDNVKAGAYGKDSVLVGGFNNLIDTVANDVTQTGENAVI
VGGDTNTVTGRRSVIVGGYQNKVSGGHSIVVGGELNETDGGGAGVFGGQSNKAAGGHSSV
LGGDHNEADGDWSSAIGGTINTASGRYATTLGGINNDAKGNESVVVGGVQNVAIGEDSTV
NGGAKNTSYGSSSYAAGGMKNMAFGNASVALGGQDSSVNGNASTGIAGGSTGENAIFTLA
AGYQSVVTDSGVEWRPITQDEADKINQGIKSWPGFSGEVDTGDGSSSPKVLDRISTAVGY
QSTADAPGVIAFGHDKGDVASVAKKWKQKATMEVDDNYSVKYYDANHKEISADDYNKLVN
SDGTLNDYTQDPIETETTYQSAYYNRLVKAADGIDAHDAVVMEQLKPYTKSDASNVGANL
KTYTVGNDGETITETDATADQKNANKDAWGKALGAEPFTTGTSDAATNASTSDQLVTGKT
LYNYDAPTAAADKKLNYVSANNTTGQNLSALDAQVKANADKGLKFAANSGAEYTAKLGST
VKIQGTAKKEGHEYTADNLTTEIDENGNITILMDKDMSVEKLAVNGKDGKDGAPGTPGSI
GINGRDGQSGVGIDGKDGISIKGRDGKDGVTMKAVDGKDGTEGHIGLTGPAGTNGINGAD
GKPGTSIDITVKNGYDGANGVNGKNGVDGTSLTRIVYKDGAGEHQVATMEDGLKFKGDDT
TVINKKLNNTLDIIGGAKGDLTEGNIGVNSTTDGKLKVQLAKDLTDITSISNQKTEGGKT
TGAKITLGTDGNVDVNGGKITHVGSGIEKDATGNITEASKTNAANIGDVQTIAESTATSL
TGKGLKFAANSGDEYTATLGSTVKIQGTAKKEGHEYTADNLTTEIDKDGNITILMDKDMS
VEKLAVNGKNGKDSAPGTPGSIGISGQDGQSGVGIDGKDGISIKGRDGKDGVTMKAVDGK
DGTEGHIGLTGPAGTNGIKGADGQTGTSIDITVKNGYDGANGVNGKNGVDGTSLTRIVYK
DGAGEHQVATMEDGLKFKGDDTTVINKKLNSTLDIIGGAKGDLTEGNIGVNSTTDGKLKV
QLAKDLTDITSISNQKTEGGKTTGAKITLGTDGNVDVNGGKITKVGSGIEEDATGNITEA
SKTNAANIGDVQTIAESTATSLTGKGLKFAANSGAEYTAKLGSKVTIQGTAKKEGHEYTA
DNLTTEIDGNGNITILMDKDMSVEKLAVNGKDGKDGAPGSIGINGRDGKSGIGIDGKDGI
SIKGRDGKDGVTMKAVDGENGTEGHISLTGPAGTNGIKGADGQPGTSIDITVKNGYDGKA
GTDGKDGVKGEKGVDGTSLTRIVYTDGAGEHQVATMEDGLKFKGDDTTVINKKLNSTLDI
IGGAKGDLTEGNIGVNNDSGKLKVQLAKDLTGITSISNQKTTKVDGKDVTTGAKITLGAD
GTTTISGGDVNVSGNKITHVGSGIETDANGKYTVTDQNKGNAANIGDVQNMVNDAKTELI
SGDNGLNNKANIDASNIGANLKDEDGKTPASDAKKTANENAWGKAIGTGEIEANNGQLVT
GNTVYNEVRPKEDGNYVKTNQTTGANLSALDSKIGKLDDDANYIKKDDSISKNLSTLDAQ
VKTNADNIANNTKSIQNITNSVKNLSDNAVQYDKDSNKTKVTLGGEGGTTITNVKDGALS
EKSSDAVNGKQLYNEQKAREAADKDITEKVTNNTNEITKIKNGDFTDASKTAIHNIAKDA
VKVVDGKNTTVTKVDGTDTTPTTYAVNVEGTGKVASGDTGLISGDTLYKEVHVDSDGSYI
KSNNTVGQNLSALDSGLKTTSDLIHTNAKGDTIQIGGNSTATKIDVSGKDKDGNTTGRVI
TGVMTDGKDLTSAANVGYVNGITSANTQQIYRDMNNAYSRLDTNINRAAAGSNALAALHP
LDFDPADKASFAVGYGHYRNANAAAVGAFYQPNANTMVNMGISIGNGDPGFNAGVSFKIG
KGSAYNGVSKAEMAQTIHDQAEEISAIKANDAAKDKRIDALEKENQEMKKQIQEILSRLN
G
NT seq 8106 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaaatatttaaagttatttacagcaaaaccaggcattgctacgttgtcgtctca
gaactagcaaaaagtcattgcaaaaccacacaaagtcataccgccagaagcaaaacagcc
ctgacggcagctgtgttgctggccttgggagctttctcgtttgtagggatgccagtggtg
caggcggccgacggcactgaaagcttacgaaataacgattttgtaggagctaatgatcaa
tattggtattatgatgaagataagggtgaatggacaacatatcaatataaattgactagt
gcctttaataaccgtgcacgaggcaaattacctaactatcagggcggtggtgcaaagttc
cctggtgccgtcaccgcaggtttatacgcacaagcaggacagcagacggttaccattggt
gatcgtaatgctggccagtcaaaaggcagtgtattcataggcgaacatagcggatataat
aatgggaataatgatcctgctgggatgaaaaacaactatgtgacatctgttgggttccaa
tctgatgctaccggttggggttctattgccatcggctctaatgcaaccgctgaaaattca
aagatggagagccaagttgtaaaagaagtagggaatgctaatacttctggtacagtaagt
gatgatacttatggaatagaagaaaacccgacaatccagggagcttctgtagctttaggc
tataacgctcattcaaaagacggtaatatcgccattggttcctattcagatgctacatct
acagataaaaatgattcctacgtctccgtaggtaatgcaaaccttaagcgtcgcattacc
aatgtcgctaaaggtaccgataactccgatgttgttaccgttggtcagatgaatgacgct
attaaacaagctgataatttgaacgtcaatgccggttggggcatcaacgttgctgatgaa
aacgacccgacgaacaccggaaagggaactaaaaatgtcatcagcctgaaacacaatctt
ggcacggggtacaacgatgacgaggctaacggcatgatcatcggcggtctggttgaagac
agagatcctgcaaaacagtacggtgctgctgatgcaaattccgttatcgtcggtgctggt
aaggccttggcatccggcaagagcagtgtcgttgtcggtggattggacaatgttgcttct
ggcgctacgtctgtagtcgtcggcggtgataacaataatgcagcaggaaatcagtctgct
gtattcggtggacgtgataacacggctgctggtattgcttctacagccggaggcggtatc
atgaatgttgccaatggtcagcaggctgttgctcttggtggtgcatacaactatgcattg
gggacttcttcaaccgccatcggcggaacgggcggcaatggtatgtatggttacagcact
agtgtaaatggtaactactcagttagtctggctggtggttctaccggtactgatgcgtta
aatggcttagcggcaggtaatcagtccgttgtcacaacagctaatggtacagccgttggc
tatcaggccacaactgataaagaaggcacgattgcgtttggccatgatgctggagatgta
tctggttatgctgtcacatggaaaaagcggaccgatggcaagacaaatgcagatcataca
accaacgattatacgcaggttcccgattctgtaactcctacgacatataaagatgcttac
tacaaccgccttgtcaaagttgccgacggtcaggatgcccatgatgtcgtcgtcatggaa
cagctgaccaaagctacaaacgatttgacgaaagacctctctgtcaatgctggctggggc
atcaacgttgctgatgaaaaagacacgaccggaaaggtaactaaaaatgtcatcagtctg
aaccgcaacctggggacgaactatgggaatccgtggaaaggtgaagggaaagtcactttt
gaagcaggtggcgaaaattccatgattcttggcggcgccgcatctatactgttcaacaac
gaaggggataatgtcaaggccggggcatatggcaaagattcggtccttgtgggcggcttc
aataatcttatcgataccgttgcaaatgatgtgactcagacaggagaaaatgctgtcatc
gttggcggtgataccaacacagttacaggccgaagatctgttattgtcggaggttatcaa
aataaggtatctggcggccattctattgtagtcggtggtgaattgaacgaaacagacggt
ggaggagccggagtatttggtggacagtcgaataaagccgctggtgggcacagttctgtc
ttaggcggcgaccataatgaagccgatggagactggtccagtgcaataggtggtacaata
aatacagcatcgggaagatatgccactactttaggcggaataaataatgatgcgaaagga
aatgaatctgttgtcgttggcggcgttcagaatgttgccataggagaggatagtacagtc
aatggcggggctaaaaataccagttatggaagttcctcttatgctgctggcggtatgaaa
aatatggcctttggcaatgcttcagttgccttaggtggtcaggattctagtgtaaatggc
aacgcttcgactggaatcgctggaggttctactggtgagaatgcgatattcaccctggct
gccggttatcaatctgtagttactgatagtggtgtagaatggcgtcctatcacacaggat
gaagcagataaaatcaatcaaggaataaaatcctggcctggattcagtggagaggtggat
actggtgatggttcttcttctccaaaggttttggaccggatttcaacagctgtcggttat
cagtccactgccgatgcgccgggagtcatcgcctttggccatgataagggagatgtagct
tccgtagcaaaaaaatggaaacagaaagccactatggaagttgacgataattattcagta
aaatattacgatgcaaaccataaggaaatttcagctgatgattataataagctagtcaat
tcagatgggacgttaaacgattacactcaggatcctattgaaacagaaacaacatatcag
tctgcctactataaccgtctcgtcaaagccgctgacggcattgatgcccatgatgccgtg
gtcatggaacagctgaaaccgtataccaaatcggacgcatctaacgttggcgctaatctg
aagacctacaccgtcggcaatgatggagaaaccattacagaaaccgatgcgacagcagac
cagaagaacgccaataaagacgcctggggcaaggctcttggtgcagaaccgtttactaca
ggcacatccgatgctgctacgaatgcttctacttcggaccagctggtaacgggcaagacg
ctgtacaactacgacgcaccgactgcagctgctgacaagaaattgaattatgtgtcggca
aacaatacgactggccagaacctgagtgctctcgatgcacaggtcaaagccaatgcagat
aagggcctgaaattcgcggctaattctggggccgaatatacggctaagctgggtagtacg
gtgaagattcagggcactgccaagaaagagggccatgaatacacggctgataatctgacc
acggaaattgatgaaaatggcaacatcaccatcctcatggataaggatatgtccgtggaa
aaacttgctgtaaacggcaaggatggcaaagatggtgctcccggcactcccggcagcatc
ggcatcaacggccgggacggccagtccggtgttggtattgacggcaaagacggtatctcc
atcaaaggcagagatggcaaagatggtgtaaccatgaaagctgtcgatggcaaggatggc
acggaaggccatatcggcctgacaggccctgctggcaccaatggcataaatggtgcagat
ggaaagccgggaacttccattgatatcaccgtcaagaacggctatgatggagcaaatggt
gtcaacggtaaaaatggtgtggatggaacgagcctgacccgtatcgtctacaaagatggt
gctggtgaacatcaggtagctaccatggaagacggcttgaaattcaagggtgatgatacg
actgtcattaacaagaagctcaacaacactctcgatatcatcggcggtgcgaagggcgac
ctgacagaaggcaacatcggcgtcaacagcacgacggatggcaagctgaaagtccagctg
gcaaaagatctgacagatatcacatccatcagcaaccagaagaccgaaggcggcaagacc
accggcgctaagattacccttggcaccgatggcaatgttgatgtcaacggtggcaagatt
acccatgtaggcagtggcattgaaaaagatgctactggtaacatcacagaagcaagcaag
acgaatgctgccaacatcggcgatgtccagaccattgcagaaagtaccgctacaagtttg
acaggcaagggactgaaattcgcggctaactctggggatgaatacacggctacgctgggc
agcacggtgaagattcagggcactgccaagaaagagggccatgaatacacggctgataat
ctgactacggagatcgataaagatggcaacatcaccatcctcatggataaggatatgtcc
gtggaaaagctggctgtaaacggcaagaatggcaaagatagtgctcccggtactcccggc
agcatcggcatcagtggccaggacggccagtccggtgttggtattgacggcaaagacggc
atctccatcaaaggcagagatggcaaagatggtgtgaccatgaaagctgtcgatggcaag
gatggcacggaaggccatatcggcctgacaggccctgctggcaccaatggcataaaaggt
gcagatggacagacgggaacttccatcgatatcaccgtcaagaacggctatgatggagca
aatggtgtcaacggtaaaaatggtgtggatggaacgagcctgacccgtatcgtctacaaa
gatggtgctggtgaacatcaggtagctaccatggaagacggcctgaaattcaagggtgat
gatacgactgtcattaacaagaagctcaacagcactctcgatatcatcggcggtgcgaag
ggcgacctgacagaaggcaacatcggcgtcaacagcacgacggatggcaagctgaaagtc
caactggcaaaagatctgacagatatcacatccatcagcaaccagaagaccgaaggcggc
aagaccaccggcgctaagattacccttggcaccgatggcaatgttgatgtcaacggtggc
aagatcaccaaggtaggcagtggcattgaagaagatgctactggtaacatcacagaagca
agcaagacgaatgctgccaacatcggcgatgtccagaccattgcagaaagtaccgctaca
agtttgacaggcaagggactgaaattcgcggctaactctggggccgaatacacggctaag
ctgggcagcaaggtgacgattcagggcactgccaagaaagagggccatgaatacacagct
gataatctgactacggagatcgatggaaatggcaacatcaccatcctcatggataaggat
atgtctgtggaaaagctggctgtaaatggcaaggatggcaaagatggtgctcccggcagc
atcggcatcaacggccgggacggcaaatccggtatcggtattgatggcaaagacggcatc
tccatcaaaggcagagatggcaaagatggtgtgaccatgaaagctgtcgatggtgaaaat
ggtacagaaggccatatcagtctcacgggacccgccggcactaatggcataaaaggtgca
gatggacagccaggaacgtcgatcgatatcaccgtcaagaatggttatgatggaaaagct
ggaacagatggcaaggatggtgtcaaaggtgaaaaaggtgtcgatggtacaagcctgaca
cgtatcgtttacacagatggtgccggtgaacatcaggtagctaccatggaagacggcttg
aaattcaagggtgatgatacgactgtcattaacaagaagctcaacagcactctcgatatc
atcggcggtgcgaagggcgacctgacagaaggcaacatcggcgtcaacaacgacagcggc
aagctgaaggtccagctggcaaaagatctgacgggcatcacgtccatcagcaatcagaag
acgactaaggttgacggcaaggatgtaaccaccggtgctaagattactcttggtgctgat
ggcacgactaccatttccggcggcgatgttaatgtcagcggcaataagattacccatgta
ggcagtggcattgaaacagatgcaaatggcaaatataccgttacagaccagaacaaaggc
aatgccgctaatatcggcgatgttcaaaacatggtcaatgatgccaagacagaattgatc
agtggtgataatggtctgaataacaaagccaatatcgatgcatccaacatcggggctaat
ctgaaagatgaagatggcaagactccggcatctgatgctaaaaagactgcaaatgaaaat
gcctggggcaaggctatcggtactggtgaaatcgaagccaataatggccagctggtaacg
ggtaataccgtctataatgaagtccgtcctaaggaagatggcaactatgtgaagacaaat
cagactacgggtgcaaatctgtcggctctggatagtaagattggcaaattggatgacgat
gcaaactacatcaagaaggatgacagtatttctaagaacctgagcacgctcgatgcacag
gtcaagaccaatgccgataatatcgcgaataacactaagtccatccagaatatcacgaac
agcgtgaaaaacctcagcgataatgctgtccagtatgacaaagattccaataagacaaaa
gtcacgctgggcggtgaaggcggcacgacaatcaccaacgtcaaggatggtgctctgagt
gaaaaaagctcggatgccgtcaatggcaagcagctctacaacgaacagaaagctcgtgaa
gcggctgacaaggacattactgaaaaggtgacgaacaacaccaatgaaattaccaagatt
aagaatggtgacttcacggatgctagcaagacagctatccataatattgccaaggatgct
gtcaaagttgtcgatggcaagaatacgacggtcactaaggtcgatggcacggatacgact
ccgacgacgtatgccgtcaatgtcgaaggcacgggcaaggtcgcttctggcgataccggt
ctgatttccggcgacacgctctataaggaagtccatgtcgatagcgatggttcctatatc
aagagtaacaatacggtcggtcagaacctgtctgctctggattcgggcctcaagacgacg
agtgacctcatacacacgaacgccaagggtgacaccatccagattggtggcaacagcacg
gctacgaagattgatgtcagcggaaaggataaggatggcaatactacaggccgcgtcatc
acaggagtcatgacagatggcaaagatctgaccagtgcggcaaatgtcggctatgtcaac
ggtattaccagtgccaatacacagcagatttaccgcgatatgaacaatgcctatagccgt
ctggatacgaacatcaacagagcggcagccggcagcaatgctttggcggctctccatccg
ctcgatttcgacccggctgataaagccagcttcgccgtcggttacggccattaccgtaac
gccaatgcagccgctgtcggtgccttctatcagccgaatgccaataccatggtcaacatg
ggcatttctattggcaatggcgacccgggcttcaatgccggtgtctccttcaagattggc
aaaggctccgcatacaacggcgtcagcaaggctgaaatggcacagacaatccatgatcag
gctgaagaaatctcggctattaaagcgaacgatgcagccaaggataaacgaatcgatgcc
ctggaaaaagaaaaccaggaaatgaagaaacagattcaggaaatcctgtcccgtctgaat
ggataa

DBGET integrated database retrieval system