KEGG   Mannheimia haemolytica M42548: MHH_c00730Help
Entry
MHH_c00730        CDS       T02635                                 

Gene name
ftsI
Definition
(GenBank) penicillin-binding protein FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00550  Peptidoglycan biosynthesis
mhx01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    MHH_c00730 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    MHH_c00730 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:mhx01011]
    MHH_c00730 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mhx03036]
    MHH_c00730 (ftsI)
Enzymes [BR:mhx01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     MHH_c00730 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:mhx01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   MHH_c00730 (ftsI)
Chromosome and associated proteins [BR:mhx03036]
 Prokaryotic type
  Chromosome partitioning proteins
   Divisome proteins
    MHH_c00730 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer OmpH
Motif
Other DBs
NCBI-ProteinID: AGK00584
LinkDB All DBs
Position
67461..69521
Genome map
AA seq 686 aa AA seqDB search
MVKSVKLKRKQEAPVAKAEPQQAEGKKTPSFLPTRFRVVVFFMLLMVGGLLAQTAYIQLF
DSERLIKEANNRSLRTKELQFTRGRILDRNGRFLSISVPMYSLTLDPREYFDTKLRRSNE
SWRALAIEMETSKGKIEANVNKFIEKKNFSKEKVDFDPRSILNTKSEGYWTQLAQVTGLD
YNSLIEKVRNNPSSVFLRLDNENLVRERQKFQALSKEIGRSYNDIMDELYSKNRQRFLYL
SRHQSEAISEYAKELDIDALVIKVESRRFYPLAEESSQLIGFTDKDDMHGSEGLERSFDS
LLIGKNGKQIIRKDAKGNIVENIRSEKQYDPQDVMLSIDEELQSMVYGEIKKAVQENNAE
SGTAVLVDVQTGEILAMANAPSFNPNKRDSFKPELMRNRAITDTFEPGSTVKPFTVLTAL
QNGVTYRDEVIGTRPFVVNGHTIKDVAPRDSLTLTGILQKSSNIGVSKLALRMPANALVD
TYTKVGFGKDTGLGLGEQRGTNGDRKRWADIERATLSYGYGLNVTPLQLARAYATLGSFG
LYRPLSITKVDPPVIGERVLPEKTTRDVVHMMESVAAKGEGGHRAAVDGYRVAIKTGTAR
KLEKGKYVEKYIAYTAGLAPASDPRFALVVLINEPKAGNYYGGFVSAPLFSRIMGYTLKQ
RNIKPDNLTENTQSAVREIKLERPIN
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atggttaaatcagttaaattaaaacgtaagcaagaagcccctgtcgcaaaagcagagcct
caacaagcagaaggtaaaaaaacaccgagttttttacctactcgctttagagtggttgtg
ttttttatgctattaatggttggtggcttactagcacaaaccgcctatattcagcttttt
gactctgaaagattaattaaagaggctaataaccgctcacttcgtactaaagaactccaa
tttacccgtggacgtattttagatcgtaacgggcgttttctctctattagtgtgccaatg
tactcattaacacttgacccgagagaatactttgatactaagctgcgtcgttctaacgaa
agctggcgtgccttagcgattgaaatggaaacatcaaaaggtaaaattgaggcaaacgtt
aataaatttattgaaaagaaaaatttttcaaaagaaaaagtagattttgatccacgttct
attttaaatactaaaagtgaaggttattggactcagcttgcccaagttacaggtttggat
tacaacagtttaatagaaaaagtacggaataaccctagctcggtttttttacgtttagat
aacgaaaatttagtaagagaacgccagaaattccaagcgttaagcaaagaaatcggccgt
tcctataatgacataatggacgagctttatagcaaaaaccgccagcgattcctttactta
tcccgtcatcaatctgaagcgatcagcgaatatgcaaaagaactagatattgatgcatta
gtgattaaagtcgaatcacgccgtttttacccgctggcagaagaatcttcacagttgatc
ggttttactgataaagatgatatgcacggttcggaagggctggagcgtagttttgattcc
ttacttatcggcaaaaacggtaaacaaattatccgaaaagatgccaaaggcaatattgtg
gaaaatatccgttcggagaaacagtacgatccgcaagatgttatgttaagcattgatgaa
gaattgcagtctatggtgtacggtgaaatcaaaaaagcggtacaggaaaataatgcggaa
tcaggcactgcggttttggttgatgtgcaaaccggcgaaattttggcaatggcaaatgcc
ccttcattcaacccaaacaaacgggatagttttaaacctgaattaatgcgtaaccgtgct
attaccgacacttttgaaccgggttcaacggtgaaaccttttaccgtattaaccgcatta
caaaatggggtaacttatcgtgatgaagttattggcactcgcccatttgtcgtcaatgga
catacaattaaagacgttgctccaagggacagccttacgcttaccggcatcttgcaaaaa
tccagtaacatcggggtcagtaaattagccctcagaatgccggcaaatgcgttagtggat
acttacacgaaagtcggtttcggtaaagacaccggtttaggcttgggtgaacaacgaggt
acgaacggtgatcgcaaacgttgggcggatattgaacgtgctaccctttcctatggatac
ggtttaaatgtgaccccattacaacttgcccgtgcttatgcgactttaggaagtttcggg
ctgtatcgcccactttcgattaccaaggtcgatccgccggtgattggcgaacgggtgcta
ccggaaaaaaccacccgagatgtcgtgcatatgatggaaagcgttgcggctaaaggcgaa
ggcggacaccgtgcagcggtggacggctaccgtgtagccatcaaaaccggtacagcacgc
aaattagaaaaaggtaaatatgttgaaaaatatattgcttataccgcagggcttgccccg
gcaagcgatcctcgctttgcattagtggtattaatcaacgaacctaaagcaggcaactat
tatggtggctttgtttctgcaccactgttctcacgcattatgggttacaccttaaaacaa
cgtaatattaagccggataacttaacggaaaatacccaaagtgccgtgcgtgaaattaaa
ttagaacgccctatcaattaa

DBGET integrated database retrieval system