KEGG   Mannheimia haemolytica M42548: MHH_c01010
Entry
MHH_c01010        CDS       T02635                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III, chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx03030  DNA replication
mhx03430  Mismatch repair
mhx03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    MHH_c01010 (holC)
   03430 Mismatch repair
    MHH_c01010 (holC)
   03440 Homologous recombination
    MHH_c01010 (holC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:mhx03032]
    MHH_c01010 (holC)
   03400 DNA repair and recombination proteins [BR:mhx03400]
    MHH_c01010 (holC)
Enzymes [BR:mhx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     MHH_c01010 (holC)
DNA replication proteins [BR:mhx03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     MHH_c01010 (holC)
DNA repair and recombination proteins [BR:mhx03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     MHH_c01010 (holC)
SSDB
Motif
Pfam: DNA_pol3_chi SBD
Other DBs
NCBI-ProteinID: AGK00604
LinkDB
Position
92814..93251
AA seq 145 aa
MKQVQFYLLSQADAAELSAAEMQACELAAQAWRLGKRVLIACETEQQALNIDEALWARDP
DSFVPHNLSGEITTYPTPIEISWKGKRNAQRRDLLISLQTQLPEFIGSFTQIIDFVPVEE
TAKAQARDRYKQYRQLGWQLETIQC
NT seq 438 nt   +upstreamnt  +downstreamnt
gtgaaacaagtacaattttatctattaagccaagccgatgcagccgagctttccgctgct
gaaatgcaagcctgcgaacttgcggctcaagcgtggcgattaggtaaacgggtactgatt
gcatgcgaaaccgagcaacaagcgttaaatattgacgaagcactttgggcaagagatccg
gattcgttcgtgccgcacaatttatcgggagaaatcaccacttacccaacgcctatcgaa
atttcgtggaaaggtaaacgcaatgctcaacgtcgggatttgttgatttcactccaaacc
caactccccgaatttatcggcagttttacccagattattgatttcgtgccggtggaagaa
accgccaaagcacaggctcgtgaccgctataaacaataccgccaacttggttggcaactg
gaaacgatacaatgctaa

DBGET integrated database retrieval system