KEGG   Mannheimia haemolytica M42548: MHH_c04910Help
Entry
MHH_c04910        CDS       T02635                                 

Definition
(GenBank) Tdh-like zinc-type threonine dehydrogenase
Organism
mhx  Mannheimia haemolytica M42548
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C AlaDh_PNT_C HI0933_like FAD_binding_3 Pyr_redox Pyr_redox_2 2-Hacid_dh_C DAO UDPG_MGDP_dh_N 3HCDH_N ApbA FAD_binding_2 Pyr_redox_3 NAD_binding_8 ADH_zinc_N_2 NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: AGK00971
LinkDB All DBs
Position
449926..450951
Genome map
AA seq 341 aa AA seqDB search
MEKPLKSVCLVEPNKVGIQTVSYPVKGENDVLIKVEGMGICGSDIGAFRGTNPLVTYPRI
LGHEIVGTVIESGKGMPNNINVGDRVIIEPYIYCGHCYPCSIGRTNCCESLKVLGVHIDG
AMQEVVRHPAHMIIKTPDMPIHELALAEPLTISLHAIHRTKVKAGEHVAIIGAGAIGLMA
ALVAKAYGATPILIDILDKRLDYAKSIGIPHTINPTKENDLEAIKSITNGRMAEVVIEAS
GANVAVQNTLKYTSFAGRIALTGWPKTETPLPTNLITFKELNIYGARTSKGAFEEALELL
ASRRIEPKDIISKVITFDEIPHYIEELSANPDDYLKIIAVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaccactcaaatcagtatgtcttgtagaacctaataaagttggtatacaaacc
gtttcttatcctgttaaaggtgaaaatgatgtgctaatcaaagtagaaggtatggggata
tgtggctctgatattggagcatttagaggcactaatccacttgttacttatcctagaatt
ttagggcatgaaatcgttggcacagtaattgagtctggtaaaggtatgccaaataatatt
aatgtaggagatcgtgtcatcattgaaccttacatctattgtggacattgctatccctgc
tccattggtagaacaaattgttgcgaatctctaaaagtattgggggtacatattgatggg
gcaatgcaagaggttgttagacatccagcccatatgataatcaaaacacctgatatgcca
atacacgaattagcgttagcagaacccttaactatttccttacacgcaattcatagaaca
aaagtcaaagctggtgaacatgttgctatcattggagcaggggcaattgggctaatggct
gcattggttgccaaagcttatggagcgacgccgattttaattgacattttagataagcga
ttggattacgcaaaatctattggtattccacacacaattaatccaacaaaagaaaacgat
cttgaagctattaaatcaattaccaatggaagaatggcagaggtggttattgaagcgtca
ggagcaaatgtcgcagtacaaaatacgcttaaatacacctcttttgctggacgtattgct
ttaaccggatggccgaaaacagaaacaccattaccaactaatttaatcaccttcaaagaa
cttaatatttatggggcaagaacaagcaagggggcatttgaagaagcattagagcttctg
gcatcaagaagaattgaaccaaaagatatcattagtaaggtaattacatttgatgaaata
cctcactatatcgaagaactctcagctaatcctgatgattacttaaaaatcatcgctgta
ttttaa

DBGET integrated database retrieval system