KEGG   Mannheimia haemolytica M42548: MHH_c09970Help
Entry
MHH_c09970        CDS       T02635                                 

Gene name
rpiA
Definition
(GenBank) ribose-5-phosphate isomerase RpiA
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mhx  Mannheimia haemolytica M42548
Pathway
mhx00030  Pentose phosphate pathway
mhx01100  Metabolic pathways
mhx01110  Biosynthesis of secondary metabolites
mhx01120  Microbial metabolism in diverse environments
mhx01130  Biosynthesis of antibiotics
mhx01200  Carbon metabolism
mhx01230  Biosynthesis of amino acids
Module
mhx_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mhx_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mhx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    MHH_c09970 (rpiA)
Enzymes [BR:mhx01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     MHH_c09970 (rpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rib_5-P_isom_A DeoRC Sugar-bind
Motif
Other DBs
NCBI-ProteinID: AGK01457
LinkDB All DBs
Position
943652..944311
Genome map
AA seq 219 aa AA seqDB search
MDQQEMKKIAAQAALKFVKPDTIVGVGSGSTVNCFIDALASMKDEIKGAVAASKASEQRL
RDIGIEVFSANEVTELDVYIDGADEITPQGAMIKGGGAALTREKIVSSLAKKFICIVDKS
KQVDVLGSTFPLPVEVIPMARSYVARQLVALGGSPEYREGVVTDNGNVILDVHNFKIMEP
LKMEHTINNIAGVVTNGIFAQRFANVTIVGTPEGAVILE
NT seq 660 nt NT seq  +upstreamnt  +downstreamnt
atggatcaacaagaaatgaaaaaaattgcggcacaagctgcattaaaatttgtaaaaccg
gacactattgttggggtgggaagtggttcaaccgtaaactgttttattgatgcccttgct
tcaatgaaagatgagattaaaggagcggttgctgcctctaaagcctcggaacagcgtttg
cgtgatatcggcattgaagtattcagtgccaatgaagtgacggaattagatgtgtatatt
gacggagctgatgaaatcacgccacaaggggcgatgattaaaggtggcggggcagcactt
acccgtgagaaaatcgtgagttcattagcgaaaaaatttatctgcattgtggataaatcc
aaacaagttgatgtgctgggttcaactttccctctgccggtggaggtgatcccaatggct
cgttcttatgtggctcgtcagctcgtagccttaggtggttcgccggaataccgtgagggc
gtggtcactgataacggcaatgtgattttagatgtacataactttaaaattatggagccg
ttgaaaatggaacataccattaataatattgcaggcgtggtgactaacggtatttttgca
caacgttttgccaatgtaaccattgtcggcacacctgaaggtgcagttattttagaataa

DBGET integrated database retrieval system