KEGG   Microbulbifer hydrolyticus: GTQ55_07750Help
Entry
GTQ55_07750       CDS       T06404                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
mhyd  Microbulbifer hydrolyticus
Brite
KEGG Orthology (KO) [BR:mhyd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GTQ55_07750 (ahpF)
Enzymes [BR:mhyd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GTQ55_07750 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like FAD_oxidored DAO FAD_binding_3 AlaDh_PNT_C NAD_binding_8 Thi4 Glutaredoxin GMC_oxred_N Thioredoxin_4 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: QHQ38887
LinkDB All DBs
Position
complement(1836790..1838382)
Genome map
AA seq 530 aa AA seqDB search
MLDANVKKQLDTYLQNIINPIEISVSANSSAKGAELNSLANEIAGLSDKIDLKQEDRKRT
PSMAIAPAGKTPRVSFAGIPMGHEFTSLVLALLQAGGHPSKADPELLEQIRNIEGEFHFE
TYISLSCQNCPDVVQALNLMANLNPNITHEMIDGALFQEEVDARQIMAVPAVYLNGEHFG
QGRMSLEEIVARIDSGAEQRQVQELNAREPYDVLVLGGGPAGAAAAIYAARKGIRTALVA
ERFGGQVMDTVGIENFISVPYTEGPKLSASLEQHVKEYGVDIITGQRAADLKRAQMIELE
LSGGATLSSKSVILATGARWRELGVPGEAEYKTRGVAYCPHCDGPFFKGKAVAVIGGGNS
GIEAAIDLAGIVKHVTVLEFADTLRADEVLVRKARSMPNIDIITNAQTTEILGDGNKVNG
LQYSNRISGESHKLELAGVFVQIGLVPNTEFLKDSGLEMNRMGEIVINERGATSIPGVFA
AGDATTVPYKQIVISMGAGATAALGAFDYLIRSSIPEDEQLQDEPLSMAG
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttggacgcaaacgtaaagaaacaactggacacctatctgcaaaatatcatcaatccg
atcgagatcagtgtgtccgccaacagcagcgccaaaggtgctgagctgaacagcctcgcc
aacgaaattgcggggctgtcagacaagattgacctcaaacaggaagaccgcaagcgcacc
ccgagcatggctattgcccccgccggtaaaaccccgcgcgtcagctttgcgggtataccc
atgggccacgaattcacctccctggtactcgccctgttgcaggccggtggccacccatcc
aaggcggacccggaactgcttgagcagatccgcaacattgagggtgaattccattttgaa
acctatatctcactgtcgtgccagaactgtccggacgtggttcaggcactgaacctgatg
gcgaacctgaacccgaacatcacccacgagatgattgacggtgccctgtttcaggaagaa
gtcgacgcgcgtcagatcatggcagtaccggcggtctacctgaatggtgaacatttcggc
cagggccgtatgagcctcgaggaaatcgtggccaggatcgatagcggcgccgagcagcgc
caggtgcaggagttgaacgcacgcgagccttacgatgtgctggtcctgggtggcggccct
gccggtgccgccgcggcgatctacgcagcgcgcaaaggtatccgcaccgcactcgtggcc
gaacgcttcggtggtcaggtaatggataccgtgggcatcgagaactttatctcggtgccg
tataccgagggcccgaaactgtccgctagcctggagcagcatgtgaaggagtacggtgtg
gatatcattaccgggcagcgcgccgccgatctcaaacgggcgcagatgattgagctggaa
ttgagcggcggcgccaccctcagcagcaagtcagtaatcctcgccacgggcgcccgctgg
cgcgaactgggtgtgccgggtgaagccgagtataagactcgcggcgtggcctactgcccg
cactgtgacggtcccttcttcaagggcaaggctgtagcggttattggcggcggcaactcg
ggtatcgaggcggccatcgacctcgcgggtatcgtcaagcatgtcaccgtgctggaattt
gccgacacgctgcgcgccgatgaggtgctggtacgcaaagcgcgctcaatgccgaatatc
gacatcattaccaatgcgcagaccaccgagatcctcggcgatggcaacaaggtgaacggt
cttcagtacagcaaccgcatcagcggtgagagccacaagctggaactggctggcgttttc
gtgcagataggtctggtacccaatactgaattcctcaaggacagcggcctggagatgaac
cgcatgggtgagatcgtcatcaacgagcgcggtgcaacgtcgatccccggcgtgttcgcc
gccggtgacgccactaccgtgccctacaagcagatcgttatctccatgggtgccggtgcg
actgcagccctcggcgccttcgattacctgatccgcagctcgattccggaagacgagcaa
ttacaagatgagcccctgtctatggccggctaa

DBGET integrated database retrieval system