KEGG   Mycoplasma hyosynoviae: MHSN_00405Help
Entry
MHSN_00405        CDS       T05673                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
mhyv  Mycoplasma hyosynoviae
Brite
KEGG Orthology (KO) [BR:mhyv00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mhyv01001]
    MHSN_00405
Enzymes [BR:mhyv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     MHSN_00405
Protein kinases [BR:mhyv01001]
 Serine/threonine kinases: Other
  Bacterial family
   MHSN_00405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo APH RIO1 Haspin_kinase Pkinase_fungal ABC1 Seadorna_VP7 FTA2 Choline_kinase DUF2951
Motif
Other DBs
NCBI-ProteinID: ASI53683
UniProt: A0A063YEG8
LinkDB All DBs
Position
complement(92836..93852)
Genome map
AA seq 338 aa AA seqDB search
MLDLSKYKNLNKNFEDFKPIGSGGFGAVYSATMKKTGERYAIKILTYANIQRMRATQFRF
KNEVEMMKKVVSPYVVQLKGAYIPKSDPNDKEYYLAMELVEGSSLKEKLERRKKLPVDEA
ISIAREICLGLVDIHNAGIVHRDLKPNNILFNENGVVKLIDFGISLSEESLRVTEDNKLV
GSVQYVAPELVVKSHSPSPQSDIYSLGIIMYEMLSGHLPFAGMDHKTIALKHVNSDLPPL
EGVNTLIPQAVENIIIKCTAKKLTDRYENCEELYRDLETCLQQERIVEDKVTLKSKKKRK
TFKEIVNSKKFTISLIASIAGTLVLLVILLGLHFGGII
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgctagatttatctaaatataagaacttaaacaaaaattttgaagattttaagccaata
ggtagtggcggttttggtgcggtttatagtgccacaatgaaaaaaactggtgaacgttat
gctatcaaaattttaacttatgcaaatatccaaagaatgcgtgcaactcaatttagattt
aaaaatgaagttgaaatgatgaaaaaagttgttagtccatatgttgttcaacttaaaggt
gcttatattcctaaatcagatccaaatgacaaagaatattatcttgcaatggagcttgtt
gaaggttcaagtttaaaagaaaaattggaacgtagaaaaaagttgccagttgatgaagct
atttctatagctcgtgaaatttgcttaggtcttgtagatattcataatgctggtattgtg
catcgtgatttaaaacccaacaacatccttttcaatgaaaatggtgttgttaaacttatt
gacttcggaatttctttaagcgaagaatcgcttagagttaccgaagataataaattggta
ggttcagtacaatatgtggcacctgaacttgttgttaaatcgcactcgccgtcacctcaa
agtgatatatattcacttggtattattatgtatgaaatgctttcaggacatttgcctttt
gctggcatggatcacaaaaccatagcactaaaacacgtaaatagcgaccttcctccccta
gaaggagtaaacactttaatacctcaagcagttgaaaatattattattaaatgtacagca
aaaaaactaactgatagatatgaaaattgtgaagaactttaccgtgaccttgaaacttgt
ttacaacaagaacgtattgtagaagataaagttacacttaaatctaagaagaaaagaaaa
acatttaaagaaattgttaatagtaaaaaatttacaatttcacttattgcatcaatagca
ggaacacttgtacttctagtaattttattaggacttcactttggaggaataatatag

DBGET integrated database retrieval system