KEGG   Methanomethylovorans hollandica: Metho_0042Help
Entry
Metho_0042        CDS       T02418                                 

Definition
(GenBank) ABC-type multidrug transport system, ATPase component
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
mhz  Methanomethylovorans hollandica
Brite
KEGG Orthology (KO) [BR:mhz00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mhz02000]
    Metho_0042
Transporters [BR:mhz02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   ABC-2 type transporter
    Metho_0042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 DUF4162 AAA_23 AAA_15 AAA_27 AAA_24 AAA_29 Rad17 SRP54 AAA_30 AAA_22
Motif
Other DBs
NCBI-ProteinID: AGB48339
UniProt: L0KWK2
LinkDB All DBs
Position
complement(47394..48302)
Genome map
AA seq 302 aa AA seqDB search
MIEVNGLRKEYGEFVAVDRLSFNVEKGEIFGIVGPNGAGKTTTLKMLSCLVHPTAGSIQI
KDIDISVNPVGVKSIIGFLPEESPLYESMYVEDYLLFFSELYDVEKHVARKRINSLLKDL
SLNAACKRIGDFSKGMRRKVAIARSLINDPELLIYDEPGSGLDPMTSRFITEYIRSLKKN
GKTIIFSAHNLYQMEKLCDRILIIKDGRQVILGSSAEIRKNHSKILYRLEFIVDDHADLC
IEGVKRLQDRFVLVTADMGTVNEITGRVVRKRGRIIEMRTMEPALEEVFLGLMGVDLTST
DG
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttaacggcttgagaaaggaatacggtgaatttgttgctgtagacaggtta
agttttaatgtggaaaaaggagagatatttggcattgtaggtcccaatggcgcaggtaag
accactaccctgaaaatgctaagctgcctggtacatcctacggcaggcagcatacagata
aaagatatcgatatatcagtgaatcctgtgggagtaaagtccataattggattcttgcca
gaagaatctcccctctatgaaagcatgtatgtggaagattacttactcttcttcagtgaa
ctatatgatgtggagaaacatgttgccagaaaaaggatcaattctttgctcaaagacctt
tcacttaatgcagcatgcaaacgaattggcgatttttccaaaggtatgcgccgtaaggtt
gctatcgcaaggtcccttatcaatgacccggaacttcttatctatgatgaaccaggttcg
gggcttgaccctatgacctccagattcataacagaatacataaggtcactcaagaaaaac
ggaaagaccattattttcagtgcacataacctatatcaaatggagaagctatgtgaccgt
attctcataataaaggatggaagacaggttatactgggctcatccgcagagatacgtaag
aatcattctaagatactttacaggttggagttcatagtcgatgaccatgctgatctttgt
atcgaaggtgtgaaacgtctgcaggacaggttcgtacttgtgacagcagatatgggtacc
gtcaatgagatcacaggacgtgtagtgagaaaacgtggcaggataattgaaatgcgcact
atggagcctgctttagaagaagtgttccttggacttatgggagtagacctaactagtaca
gatggctga

DBGET integrated database retrieval system