KEGG   Methanomethylovorans hollandica: Metho_1681Help
Entry
Metho_1681        CDS       T02418                                 

Definition
(GenBank) ATP-dependent DNA ligase I
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
mhz  Methanomethylovorans hollandica
Pathway
mhz03030  DNA replication
mhz03410  Base excision repair
mhz03420  Nucleotide excision repair
mhz03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:mhz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Metho_1681
   03410 Base excision repair
    Metho_1681
   03420 Nucleotide excision repair
    Metho_1681
   03430 Mismatch repair
    Metho_1681
Enzymes [BR:mhz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Metho_1681
    6.5.1.6  DNA ligase (ATP or NAD+)
     Metho_1681
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Metho_1681
DNA replication proteins [BR:mhz03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Metho_1681
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Metho_1681
DNA repair and recombination proteins [BR:mhz03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Metho_1681
   NER (nucleotide excision repair)
    Other NER factors
     Metho_1681
   MMR (mismatch exicision repair)
    Other MMR factors
     Metho_1681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: AGB49874
UniProt: L0L0V2
LinkDB All DBs
Position
1671185..1672870
Genome map
AA seq 561 aa AA seqDB search
MTSFREFCRTCKVIEETAGSLDMTALVAELFSLVTSEELPVVTHFVMGEVFPAWSDEEVG
LGTGILLNALSKSSGLPVKEIEDVVRETGDIGKTTVKVLGKISKGQATFSSFLDSPVELS
IMEVYERFKDIAHATGKGSQTSRIKHLQYLFNSASAEDVGYIARLAIEDMRIGVGEGIVR
DAIAKAFEVPVASVERGFMLTNDMGIVAVTAKEGGDEALLELGLQIGRPIKLMLAQVTPD
IETAIRELGVVAAEWKFDGARVQIHKKGDEVILYSRRLENITGSLPDIVSSVKRAVKADS
AILDGEAVAIDENGRPKPFQEILKRLRRKHDVQNKVRHIPLILNLFDIMYLDGESLIELP
LQKRREFLVASVENDDLVRVDSQLITSDLSQIENMYEQALSAGHEGIMIKNPASPYSPGK
RGKNWLKKKPVMETLDLVVIGAEWGYGRRTSFLGSYALACHDPDTGQFLPVGKVATGISD
EQLAELTEMFREHVISGSGTSVEIRPHILFEVAFEEIQKSTNYESGYALRFPRLVRVRDD
KSLEEVDTLERLEDMYRTQRK
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgacaagcttcagggagttctgcaggacatgtaaagtcatagaagaaacagccggatct
ctggatatgacagctcttgtggcagagctcttctctcttgtgacaagtgaggagttgccg
gtagtaactcattttgtcatgggcgaagtctttcccgcatggagtgatgaagaagtaggc
ctgggcacaggtattcttctcaatgcactttccaaatcatcaggtctgccagtgaaggaa
atagaagacgtagtaagggaaaccggagatataggcaagactacagtgaaagttctgggc
aaaatatctaaggggcaggctactttttcttcgtttttagactcacctgtggaactaagc
atcatggaagtctatgaaagattcaaggacatagcccatgcaacaggcaaggggtcccag
acatccaggataaagcatctacaatatctttttaactcggcgtctgctgaagatgttggg
tatatagccaggcttgccatagaggacatgaggataggtgtgggagaaggtattgtcagg
gatgccattgcaaaggcttttgaagttcccgtagcatccgttgaaagaggcttcatgctc
actaatgacatgggaattgtggctgtcactgcaaaagaaggtggtgatgaggctctttta
gaattaggattgcagataggcaggcctataaaactaatgcttgcacaagtaacaccggat
attgaaactgctataagggagctgggagttgtcgctgcagagtggaaatttgatggtgcc
agggtgcagatacataaaaagggcgatgaggtcatcctctactcccggcgcctggagaac
atcacaggctcgcttcccgacattgtatcgtcagtaaagagggcagtaaaagctgattct
gccatacttgacggggaggctgtggcgattgacgaaaatggaagaccgaaaccattccag
gagatccttaagcgtctcagacgtaaacatgatgtacagaacaaggtaagacacatacca
cttattcttaacctttttgacatcatgtaccttgatggtgaaagccttatagagctcccc
ctgcaaaagagacgggaattccttgtagcctctgtagagaacgatgatctcgtccgcgtg
gacagccagctcataacatcagacctttcacagatagaaaacatgtatgaacaggcattg
agtgcaggtcatgaaggcattatgataaagaaccctgcatctccatattcaccgggaaag
cggggaaagaactggcttaagaaaaaaccagttatggaaactctggaccttgtagtaata
ggggcggaatggggctatggcagaaggacaagttttcttggttcttatgcattggcctgt
catgaccctgacacaggccagttcctgccggtaggtaaagtggccaccggaatatctgat
gagcaactggcagaactaacagaaatgttcagggaacatgtcatttcaggatccggtact
agtgtggagatcagaccgcatatactctttgaagtggctttcgaagagatacagaagagc
acgaactatgagtctggatatgcattgcgctttccacggcttgtacgtgtaagagatgat
aagtcactggaagaggttgacacgctggaacgtcttgaggacatgtacaggacccagcgt
aaatga

DBGET integrated database retrieval system