KEGG   Mycobacterium intracellulare ATCC 13950: OCU_17300Help
Entry
OCU_17300         CDS       T02158                                 

Definition
(GenBank) hypothetical protein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AFC42949
UniProt: H8IPE9
LinkDB All DBs
Position
complement(1766646..1768112)
Genome map
AA seq 488 aa AA seqDB search
MTKNSDHRCYDEVFIGGQWRKPANPQQLEVISPHSEEPVGHVQAAGPEDVDAAVVAARHA
FDHGPWPRMSHADRMAKVEQLAAIYARHSDDMADLITDEMGSPRSFSRMGQGAAAASLIH
LALAAARDFPWTERRQGVLGEVHLRRAPVGVVGAIVPWNVPQFLIMPKLIPALIAGCTVI
VKPAPETPLDALWLAEMIEQLDLPEGVVSVLPGGTDVGEALVRHPGVDKIAFTGSSAVGR
RIAALCGEQLKRVSLELGGKSAAIILDDADIDKTVAGLKSAGLMNNGQACVAQTRILVSD
RKHDEVVDALAGMMSALHVGDPADEATDIGPLVAQRQQRRVQDYIQSGRREGARVVLGGE
QSPSERGWYVQPTLFADATNDMRIAREEIFGPVLTVLRYRDEDDAIRIANETDYGLAGSV
WTSDIGHGLDVAAAVRTGTYGINMYTLDIGAPFGGFKQSGIGREFGPEGLHEYVELQTLI
CKGQLPPL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagaattccgaccatcgttgttacgacgaagtgttcatcggagggcagtggcgc
aagcccgccaatccccaacagctcgaagtgatctcgccgcactccgaggagccggtcggt
cacgtccaggcggccggccccgaggacgtcgacgccgccgttgtcgccgctcggcacgcc
ttcgaccacggaccgtggccgcggatgagccacgccgatcggatggccaaagtcgaacag
ctcgccgcgatctacgcccgccacagcgacgacatggccgacctgatcaccgacgagatg
ggatcaccgcgcagtttcagccggatgggccagggggcggccgccgcgtcgctgatccac
ctcgcgctggccgccgcccgcgactttccgtggaccgaacgccgccagggcgtgctcggc
gaagtgcacctgcgccgggccccggttggggtggtgggcgcgatcgtgccctggaacgtg
ccccagtttttgatcatgcccaagctgatccccgcgctcatcgcggggtgcacggtgatc
gtcaagcccgcacccgaaacgcctttggacgctttgtggttggccgagatgatcgagcag
cttgacctgcccgagggcgtggtctcggtgctgcccggcggcaccgacgtcggcgaggcg
ctggtgcgccaccccggcgtggacaagatcgcgttcaccgggtccagcgccgtcgggcgc
cggatcgccgcgctgtgcggggaacaactgaaacgcgtgagcctggagctgggcggcaaa
tcggcggcgatcatcctcgacgacgccgacatcgacaagaccgtggccgggttgaagagc
gcgggcctgatgaacaatggccaggcctgcgtcgcccagacccgcatcctggtcagcgac
cgcaagcacgacgaggtcgtcgacgccctggccggcatgatgtcagcgctgcacgtcggt
gacccggccgacgaggcaacggacatcggaccgcttgtcgcccaacgccaacagcgccgc
gtccaggactacatccagtccggccgccgcgaaggggcccgcgtcgtcctgggtggcgaa
cagagcccgtccgagcgcggttggtacgtgcagccgacgctgttcgccgacgccaccaac
gacatgcgcatcgcccgggaggagattttcgggccggtgctcacggtgctgcgctaccgg
gacgaggacgacgcgatccgcatcgccaacgagaccgactacggtctggccggttcggtg
tggacgtccgacatcgggcacggcctcgacgttgcggccgccgtccgcacggggacctac
ggcatcaacatgtacaccctcgacatcggggcaccgttcggcggtttcaagcaatccggc
atcgggcgggagttcggccccgagggtctgcacgagtatgtcgaactgcagacgctgata
tgcaaagggcagttgccacccctatga

DBGET integrated database retrieval system