KEGG   Mycobacterium intracellulare ATCC 13950: OCU_28150Help
Entry
OCU_28150         CDS       T02158                                 

Definition
(GenBank) lipoprotein
Organism
mia  Mycobacterium intracellulare ATCC 13950
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MitoNEET_N
Motif
Other DBs
NCBI-ProteinID: AFC44034
UniProt: H8INT6
LinkDB All DBs
Position
complement(2949646..2950176)
Genome map
AA seq 176 aa AA seqDB search
MRNAFARLYGSHPLHLLTMIAGFAVLGYVVATVKPATLWNPDVWWQSIVVWFAGAVVAHD
LVLFPVYAGLDRLLSRRAPRPGPDVPVLNHLRVPALGAGLTLLVFLPGIIRQGGATYRAA
TGQTQDPFLGRWLLLTAAMFAVSAAAYAIRTARARQRTRAREMAPRATNQRPGDGP
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaacgcgttcgcgaggctctacgggtcccacccgctgcacctgctgacgatgatc
gccggattcgcggtgctgggctacgtggtcgccacggtcaaaccggccacgctgtggaac
cccgacgtgtggtggcagtcgatcgtcgtgtggttcgccggggccgtcgtcgcccacgat
ctggtgttgttcccggtctacgcgggcctcgaccggctgctgtcccgccgagcgccgcgc
cccggtcccgacgtgcccgtgctcaaccatctccgggtgcccgcgctgggggcgggcctc
acgctgctggtgttccttcccggcatcatcaggcagggcggcgccacgtaccgggcggcg
accggccagacccaggacccattcctgggtcggtggctgttgttgaccgcggcgatgttc
gcggtcagcgccgcagcctatgccatccggacggcaagggcgcggcagcggacccgggcg
cgggaaatggcgccccgggcaacgaatcaacgccccggcgacgggccttag

DBGET integrated database retrieval system